(data stored in ACNUC7421 zone)

EMBL: FM180568.YAHJ

FM180568.YAHJ        Location/Qualifiers
FT   CDS_pept        320679..322061
FT                   /transl_table=11
FT                   /gene="yahJ"
FT                   /locus_tag="E2348C_0286"
FT                   /product="predicted deaminase with
FT                   metallo-dependenthydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07834"
FT                   /db_xref="GOA:B7UJH7"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJH7"
FT                   /protein_id="CAS07834.1"
FT                   /translation="MKENNSRREFLSQSGKMVTAAALFGPSVPLAHAGVAGTLNCEANN
FT                   TMKITDPYYYLDNVLLETGFDYENGVAVQTRTARQTVEIQDGKIVALRENKQHPDATLP
FT                   HYDAGGKLMLPTTRDMHIHLDKTFYGGPWRSLNRPAGTTIQDMIKLEQKMLPELQPYTQ
FT                   ERAEKLIDLLQSKGTTIARSHCNIEPVSGLKNLQNLQAVLARRQAGFECEIVAFPQHGL
FT                   LLSKSEPLMREAMQAGAHYVGGLDPTSVDGAMEKSLDTMFQIALDYDKGVDIHLHETTP
FT                   AGVAAINYMVETVEKTPQLKGKLTISHAFALATLNEQQVDELAHRMVAQQISIASTVPI
FT                   GTLHMPLKQLHDKGVKVMTGTDSVIDHWSPYGLGDMLEKANLYAQLYIRPNEQNLSRSL
FT                   FLATGDVLPLNEKGERVWPKAQDDASFVLVDASCSAEAVARISPRTATFHKGQLVWGSV
FT                   AG"
     atgaaagaaa acaatagccg ccgtgaattt ctgagccaga gcggtaagat ggtcaccgcc        60
     gccgcgctgt ttggtccctc agtgccgctc gcccatgcgg gggtagctgg caccctaaac       120
     tgcgaagcga acaacaccat gaaaatcact gacccgtatt actatctcga taacgtgctg       180
     ctggaaaccg gttttgacta cgaaaatggc gtggcggtac agacccgcac ggcgcgccag       240
     accgtggaga ttcaggacgg taaaattgtt gccctgcgcg agaacaagca gcatccggac       300
     gccacgctgc cgcactatga cgctggcggt aagctgatgc tgcccaccac ccgcgacatg       360
     catattcatc tcgacaaaac cttctacggc gggccgtggc gctcgctcaa tcgtccggca       420
     ggcaccacta tccaggacat gatcaaactc gagcagaaaa tgctgccgga actgcaaccg       480
     tacacgcagg aacgggcgga aaaactgatc gatttattgc agtcgaaagg caccaccatt       540
     gcccgcagcc actgcaatat cgaaccggtt tccggcctga aaaatctgca aaatttgcag       600
     gcggtgctgg cgcgacgtca ggcgggcttc gagtgtgaaa tcgtcgcctt cccgcagcac       660
     ggtttgctgc tgtcgaaatc ggaaccctta atgcgcgaag cgatgcaggc gggggcgcat       720
     tatgtcggcg ggctggaccc gaccagtgtc gatggcgcga tggaaaaatc cctcgacacc       780
     atgttccaga ttgcgctgga ctatgacaaa ggcgtcgata ttcacctgca cgaaaccacg       840
     ccggcaggcg tggcagccat caattatatg gttgaaacag tggagaaaac gccgcagcta       900
     aaaggcaagc tgaccatcag tcacgccttt gcgctggcaa cgctcaacga acaacaggta       960
     gatgaactgg cgcaccggat ggtggcgcag caaatttcta tcgcctcgac ggtgccgatt      1020
     ggcacgctgc atatgccgct caaacagttg cacgacaaag gcgtaaaagt gatgaccggc      1080
     accgacagcg ttatcgacca ctggtcgcct tacggcctgg gcgacatgct ggaaaaagcc      1140
     aatctgtacg cgcagctcta tattcgtcct aacgaacaga acctctcccg ctctctgttt      1200
     ttagccactg gcgatgtatt gccgctcaac gaaaaaggcg agcgcgtgtg gcccaaagcg      1260
     caggatgatg ccagctttgt gctggtggac gcctcctgtt ccgccgaggc ggtggcgcgt      1320
     atttcgccga gaacggcgac gttccataaa gggcaactgg tgtggggaag tgtggcaggt      1380
     tga                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page