(data stored in ACNUC7421 zone)

EMBL: FM180568.YAHO

FM180568.YAHO        Location/Qualifiers
FT   CDS_pept        325185..325460
FT                   /transl_table=11
FT                   /gene="yahO"
FT                   /locus_tag="E2348C_0289"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07837"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJH9"
FT                   /protein_id="CAS07837.1"
FT                   /translation="MKIISKMLVGALAFAVTNVYAAELMTKAEFEKVASQYEKIGDIST
FT                   SNEMSTADAKEDLIKKADEKGADVLVLTSGQTDNKIHGTANIYKKK"
     atgaaaataa tctctaaaat gttagtcggt gcgttagcgt ttgccgttac caatgtctat        60
     gccgcagaat taatgaccaa agcggaattt gaaaaggttg catcgcaata tgaaaaaata       120
     ggtgatattt caaccagtaa tgaaatgtcg accgcagatg cgaaagaaga tttgatcaaa       180
     aaagccgatg aaaaaggggc tgatgtgttg gtactgacct ccggtcaaac tgacaataag       240
     atccacggca cggcaaatat ttataagaag aagtaa                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page