(data stored in ACNUC7421 zone)

EMBL: FM180568.YAIA

FM180568.YAIA        Location/Qualifiers
FT   CDS_pept        366135..366326
FT                   /transl_table=11
FT                   /gene="yaiA"
FT                   /locus_tag="E2348C_0325"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07873"
FT                   /db_xref="InterPro:IPR032303"
FT                   /db_xref="InterPro:IPR038462"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJL3"
FT                   /protein_id="CAS07873.1"
FT                   /translation="MPTKPPYPREAYIVTIEKGKPGQTVTWYQLRADHPKPDSLISEHP
FT                   TAQEAMDAKKRYEDPDKE"
     atgccaacga aaccgcctta tcctcgtgaa gcatatatag tgacgattga aaaaggaaag        60
     ccaggacaga cggtaacctg gtaccaactc agagccgatc atcctaaacc agactcgttg       120
     atcagtgaac atccgaccgc tcaggaagcg atggatgcga aaaaacgcta tgaggaccct       180
     gacaaagagt ga                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page