(data stored in ACNUC7421 zone)

EMBL: FM180568.YAIE

FM180568.YAIE        Location/Qualifiers
FT   CDS_pept        367333..367617
FT                   /transl_table=11
FT                   /gene="yaiE"
FT                   /locus_tag="E2348C_0327"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07875"
FT                   /db_xref="GOA:B7UJL5"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UJL5"
FT                   /protein_id="CAS07875.1"
FT                   /translation="MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGEYTFSTAEPEEM
FT                   TVISGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVAEPTSYLCRYL"
     atgcttcaaa gtaatgagta cttttccggc aaagtgaaat cgatcggctt ttccagcagc        60
     agcactggtc gcgccagcgt gggtgttatg gttgaaggtg aatacacctt cagcaccgct       120
     gagcctgaag agatgacggt aatcagtggt gcgctgaatg tgttactgcc tgacgcgacc       180
     gactggcaag tgtatgaagc cggttcggtg tttaatgttc ccggtcacag cgagtttcat       240
     ctgcaagttg ccgaacccac ctcttatctg tgccgctatc tgtaa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page