(data stored in ACNUC7421 zone)

EMBL: FM180568.YAII

FM180568.YAII        Location/Qualifiers
FT   CDS_pept        364920..365378
FT                   /transl_table=11
FT                   /gene="yaiI"
FT                   /locus_tag="E2348C_0323"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07871"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UJL1"
FT                   /protein_id="CAS07871.1"
FT                   /translation="MTIWVDADACPNVIKEILYRAAERMQMPLVLVANQSLRVPPSRFI
FT                   RTLRVAAGFDVADNEIVRQCEAGDLVITADIPLAAEAIEKGAAALNPRGERYTPATIRE
FT                   RLTMRDFMDTLRASGIQTGGPDSLSQRDRQAFAAELEKWWLEAQRSRG"
     atgacaattt gggtggatgc cgacgcgtgt cccaatgtaa ttaaagagat tttgtatcgc        60
     gcggcggaac gtatgcagat gccgctggta ctggtagcaa accagagttt acgcgtgccg       120
     ccatcacgat ttattcgtac gctgcgcgtc gcggcaggtt tcgacgttgc cgataacgaa       180
     attgttcggc agtgtgaagc gggcgatttg gtgatcaccg cagatatacc tttggctgct       240
     gaagccatcg agaaaggcgc ggcggcgctt aatccgcgcg gcgaacgtta tacgccagcg       300
     accattcgtg agcgcctgac gatgcgcgat tttatggata ccttacgtgc cagtgggatc       360
     cagaccggag gaccagatag tctttcacaa cgtgaccgcc aggcctttgc tgcggagctg       420
     gagaagtggt ggctggaagc gcaacgtagt cgtggctaa                              459
//

If you have problems or comments...

PBIL Back to PBIL home page