(data stored in ACNUC7421 zone)

EMBL: FM180568.YAIY

FM180568.YAIY        Location/Qualifiers
FT   CDS_pept        complement(358181..358489)
FT                   /transl_table=11
FT                   /gene="yaiY"
FT                   /locus_tag="E2348C_0315"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07863"
FT                   /db_xref="GOA:B7UJK3"
FT                   /db_xref="InterPro:IPR020513"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJK3"
FT                   /protein_id="CAS07863.1"
FT                   /translation="MADFTLSKSLFSGKYRNASSTPGNIAYALFVLFCFWAGAQLLNLL
FT                   VHAPGVYERLMQVQETGRPRVEIGLGVGTIFGLIPFLVGCLIFAVVALWLHWRHRRQ"
     atggctgatt tcaccctgtc aaaatcgctg tttagcggaa aatatcgcaa tgcctcttca        60
     acgcctggca atattgccta tgcgttgttt gtgctgtttt gcttttgggc tggggcacaa       120
     ttgctgaacc tgctagtgca tgcgcccggc gtctatgagc gtttaatgca ggtccaggaa       180
     acaggtcgcc cacgggtgga aattggttta ggtgtcggca ccatttttgg gctgatcccg       240
     tttttagtag gctgcctcat ttttgcagta gtggcgctat ggctgcactg gcgacatcgc       300
     cgccagtaa                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page