(data stored in ACNUC7421 zone)

EMBL: FM180568.YAJC

FM180568.YAJC        Location/Qualifiers
FT   CDS_pept        386455..386787
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="E2348C_0342"
FT                   /product="SecYEG protein translocase auxillary subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07890"
FT                   /db_xref="GOA:B7UJN0"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJN0"
FT                   /protein_id="CAS07890.1"
FT                   /translation="MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKR
FT                   TKEHKKLMDSIAKGDEVLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPK
FT                   GTMKAL"
     atgagctttt ttatttctga tgcggtagcg gcaacgggtg caccggcgca aggtagcccg        60
     atgtctttga ttttgatgct ggtggtattc ggtctgattt tctatttcat gatcctgcgt       120
     ccacagcaga agcgcaccaa agaacacaaa aagctgatgg actccatcgc taaaggtgat       180
     gaagtgctga cgaacggtgg cctggtcggt cgcgtaacca aagtagcgga aaacggctac       240
     attgctatcg cactgaatga caccactgaa gtagttatta aacgtgactt cgtagctgcc       300
     gttctgccga aaggcaccat gaaggcgctg taa                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page