(data stored in ACNUC7421 zone)

EMBL: FM180568.YAJD

FM180568.YAJD        Location/Qualifiers
FT   CDS_pept        389773..390120
FT                   /transl_table=11
FT                   /gene="yajD"
FT                   /locus_tag="E2348C_0345"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07893"
FT                   /db_xref="GOA:B7UJN3"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJN3"
FT                   /protein_id="CAS07893.1"
FT                   /translation="MAIIPKNYARLESGYREKALKIYPWVCGRCSREFVYSNLRELTVH
FT                   HIDHDHTNNPEDGSNWELLCLYCHDHEHSKYTEADQYGTTVIAGEDAQKDVGEAKYNPF
FT                   ADLKAMMNKKK"
     atggctataa tcccaaaaaa ctatgcgcgg ttagaaagcg gctatcgcga aaaagcatta        60
     aaaatctatc cgtgggtctg cggtcgctgt tctcgcgagt ttgtttattc caacctgcgt       120
     gaacttaccg ttcaccacat tgatcacgac cataccaata acccggaaga cggcagtaac       180
     tgggagttat tgtgtcttta ttgccacgat cacgagcatt caaaatatac cgaagcagat       240
     cagtatggta cgaccgttat cgcaggggaa gatgcgcaga aagatgtcgg tgaagcgaag       300
     tacaacccat tcgctgacct gaaagcgatg atgaacaaga agaagtga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page