(data stored in ACNUC7421 zone)

EMBL: FM180568.YAJL

FM180568.YAJL        Location/Qualifiers
FT   CDS_pept        complement(401955..402545)
FT                   /transl_table=11
FT                   /gene="yajL"
FT                   /locus_tag="E2348C_0359"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07907"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJP7"
FT                   /protein_id="CAS07907.1"
FT                   /translation="MSASALVCLAPGSEETEAVTTIDLLVRGGIKVTTASVASDGNLAI
FT                   TCSRGVKMLADAPLVEVADGEYDVIVLPGGIKGAECFRDSTLLVETVKQFHRSGRIVAA
FT                   ICAAPATVLVPHDIFPIGNMTGFPTLKDKIPAEQWQDKRVVWDARVKLLTSQGPGTAID
FT                   FGLKIIDLLVGREKAHEVASQLVMAAGIYNYYE"
     atgagcgcat cggcactggt ttgcctcgcc cctggtagtg aagagactga agccgtcacc        60
     actatcgacc tcttggttcg cggcggtatc aaagtcacca ctgccagcgt cgccagcgat       120
     ggtaacctgg caattacctg ctcgcgcggc gtaaagatgc tggcggatgc gccgctggtc       180
     gaagtggctg atggcgaata tgacgtgatt gtgctgcctg gtggcatcaa aggcgcagag       240
     tgttttcgcg atagcaccct gctggttgaa accgttaaac agttccaccg ttccgggcgt       300
     atcgtcgcgg ctatttgcgc cgcgccagcc accgtgctgg tcccgcacga tatcttcccg       360
     attggcaata tgaccggctt cccgacgctg aaagacaaaa ttcccgccga acaatggcag       420
     gacaagcgcg tcgtctggga tgcacgagta aaattgctga ccagccaggg gccgggtaca       480
     gctatcgact ttggtctgaa aattatcgac ctgctggttg gccgtgaaaa agcccatgaa       540
     gtggcatcac aactggtgat ggcggcaggg atttataatt attacgagta g                591
//

If you have problems or comments...

PBIL Back to PBIL home page