(data stored in ACNUC7421 zone)

EMBL: FM180568.YAJQ

FM180568.YAJQ        Location/Qualifiers
FT   CDS_pept        403587..404078
FT                   /transl_table=11
FT                   /gene="yajQ"
FT                   /locus_tag="E2348C_0361"
FT                   /product="predicted nucleotide binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07909"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UJP9"
FT                   /protein_id="CAS07909.1"
FT                   /translation="MPSFDIVSEVDLQEARNAVDNASREVESRFDFRNVEASFELNDAS
FT                   KTIKVLSESDFQVNQLLDILRAKLLKRGIEGSSLDVPENIVHSGKTWFVEAKLKQGIES
FT                   ATQKKIVKMIKDSKLKVQAQIQGDEIRVTGKSRDDLQAVMAVVRGGDLGQPFQFKNFRD
FT                   "
     atgccatctt tcgatattgt ctctgaagtt gatcttcagg aagcacgtaa cgcggtcgat        60
     aacgcgagcc gcgaagtgga gtcccgtttt gacttccgta acgttgaagc ctcatttgag       120
     ctgaatgacg ccagcaaaac catcaaagtg ttgagcgagt ccgacttcca ggtcaatcag       180
     ttgctggata ttctgcgtgc caagttgctg aagcgcggca ttgaaggcag ttcactggat       240
     gtaccggaaa atatcgttca tagcggtaaa acctggtttg tggaagcgaa actgaaacag       300
     ggcattgaga gcgcgactca gaagaaaatc gtcaaaatga tcaaagacag caaactgaaa       360
     gtgcaggcgc aaattcaggg cgatgagatc cgcgtaacgg gtaaatctcg tgatgattta       420
     caggctgtca tggcggtggt acgtggtggc gatctcggtc agccgttcca gttcaaaaac       480
     ttccgcgatt aa                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page