(data stored in ACNUC7421 zone)

EMBL: FM180568.YBAA

FM180568.YBAA        Location/Qualifiers
FT   CDS_pept        437147..437500
FT                   /transl_table=11
FT                   /gene="ybaA"
FT                   /locus_tag="E2348C_0391"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07939"
FT                   /db_xref="InterPro:IPR009874"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKD7"
FT                   /protein_id="CAS07939.1"
FT                   /translation="MKYVDGFVVAVPADKKDAYREMAAKAAPLFKEFGALRIVECWASD
FT                   VPDGKVTDFRMAVKAEENEEVVFSWIEYPSKEVRDAANQKMMSDPRMKEFGESMPFDGK
FT                   RMIYGGFESIIDE"
     atgaagtatg ttgatggttt tgtggttgcc gttcctgccg ataaaaagga tgcctatcgg        60
     gaaatggccg ctaaggccgc gccattgttt aaagagtttg gcgcgcttcg tattgtcgaa       120
     tgctgggcca gcgatgtacc ggatggtaaa gtgaccgatt ttcgtatggc ggtgaaagcg       180
     gaagagaatg aagaggttgt ctttagctgg attgaatacc cttcaaaaga ggtccgcgac       240
     gctgctaatc aaaagatgat gtcggaccca cggatgaaag agttcggcga gtccatgccg       300
     tttgacggca agcgaatgat ctatggtgga ttcgaatcaa tcatcgacga gtag             354
//

If you have problems or comments...

PBIL Back to PBIL home page