(data stored in ACNUC7421 zone)

EMBL: FM180568.YBAE

FM180568.YBAE        Location/Qualifiers
FT   CDS_pept        complement(424529..426229)
FT                   /transl_table=11
FT                   /gene="ybaE"
FT                   /locus_tag="E2348C_0380"
FT                   /product="predicted transporter subunit:
FT                   periplasmic-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07928"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJR8"
FT                   /protein_id="CAS07928.1"
FT                   /translation="MRLLNRLNQYQRLWQPSAGKPQTVTVSELAERCFCSERHVRTVLR
FT                   QAQEAGWLEWQAQSGRGKRGQLRFLVTPESLRNAMMEQALETGKQQDVLELAQLAPGEL
FT                   RTLLQPFMGGQWQNDTPTLRIPYYRPLEPLQPGFLPGRAEQHLAGQIFSGLTRFDNNTQ
FT                   RPIGDLAHHWETSTDGLRWDFYLRSTLHWHNGDAVKASHLHQRLLMLLQLPALDQLFIS
FT                   VKRIEVTHPQCLTFFLHRPDYWLAHRLASYCSHLAHPQFPLIGTGPFRLTQFTAELVRL
FT                   ESHDYYHLRHPLLKAVEYWITPPLFEKDLGTSCRHPVQITIGKPEELQRVSQVSSGISL
FT                   GFCYLTLRKSPRLSLWQARKVISIIHQSGLLQTLEVGENLITASHALLPGWTIPQWQVP
FT                   DEVKLPKTLTLVYHLPIELHTMAERLQATLAAEGCELTIIFHNAKNWDDTTLLAHADLM
FT                   MGDRLIGEAPEYTLEQWLRCDPLWPHVFDAPAYAHLQSTLDAVQVMPDEENRFNALKAV
FT                   FSQLMADATLTPLFNYHYRISAPPGVNGVRLTPRGWFEFTEAWLPAPSQ"
     atgcgactgc tcaaccgtct taaccagtat caacgtctgt ggcaaccttc cgccgggaag        60
     ccgcaaaccg tcaccgtcag cgaactggcc gaacgctgtt tttgcagcga acgccatgtt       120
     cgtacggtgt tgcgtcaggc acaggaggcg ggatggctgg agtggcaggc acagtcagga       180
     cgcggaaagc gcggacaact gcgctttctg gtcacgccgg aatcgctacg caatgcgatg       240
     atggaacagg cactggaaac cggaaagcag caagatgtgc tggagctggc gcaactggcc       300
     ccaggtgagc tgcgcactct gttacagccg tttatgggcg gacaatggca aaacgatacg       360
     cccacgttgc gtattcccta ctatcgcccg ctcgaaccgc tacaaccggg ctttttgccc       420
     ggccgtgccg agcagcatct cgccggacag atattttccg gcctgacccg cttcgataat       480
     aatacccagc gcccgattgg cgatttagcg catcactggg aaacctctac tgacgggtta       540
     cgctgggact tttatcttcg ttcaacccta cactggcata acggcgatgc agtaaaagcc       600
     tcccacttac accagcggtt attgatgctg ttacaactgc cagcactgga tcaattattc       660
     attagcgtga agcgtattga agtcacccat ccgcagtgtc tgaccttctt tttacatcgc       720
     cctgattact ggcttgctca ccggctggcg agctattgca gccatctggc gcatccgcaa       780
     ttcccactga tcggcacggg tccttttcgc ttaacacaat tcacagcgga gctggtgcgc       840
     ctggaaagcc atgattatta ccatttacgt catccgctgc ttaaagcggt tgagtactgg       900
     ataactccgc cgcttttcga aaaagatttg ggaaccagtt gtcggcatcc cgtgcaaatc       960
     accatcggca aaccggagga gctgcaacgg gtcagccagg tcagtagtgg catcagttta      1020
     ggtttttgct atttaacgtt gcgcaaaagt ccccgactgt ccctctggca ggcgcgaaaa      1080
     gtgatctcca ttattcatca atccggttta ttacaaacgt tagaagtcgg agaaaacctg      1140
     atcaccgcca gtcatgcatt actgccaggc tggactattc cgcaatggca agtaccggat      1200
     gaggtcaaac taccgaaaac cttgacgctg gtttatcacc taccgataga acttcatacc      1260
     atggcagaac gcctacaggc gacactggca gcggaaggct gtgaactcac aattattttt      1320
     cataacgcaa aaaactggga cgacacgacc ctactggcac acgcagacct catgatgggc      1380
     gacagattaa ttggcgaagc accggaatat accctggagc aatggctgcg ttgcgatcca      1440
     ctgtggccac atgttttcga cgctccagca tatgcacatt tgcaatcgac actggacgcg      1500
     gtgcaagtta tgcctgatga ggaaaaccga tttaatgccc tgaaagcggt ttttagccag      1560
     ttaatggcag atgcgacgct gacaccgctg ttcaactatc actatcgcat tagcgcccct      1620
     cccggcgtga acggtgtgcg actgacaccg cgcggctggt ttgaatttac cgaagcctgg      1680
     cttcccgcgc cgtcgcaatg a                                                1701
//

If you have problems or comments...

PBIL Back to PBIL home page