(data stored in ACNUC7421 zone)

EMBL: FM180568.YBAL

FM180568.YBAL        Location/Qualifiers
FT   CDS_pept        complement(461932..463608)
FT                   /transl_table=11
FT                   /gene="ybaL"
FT                   /locus_tag="E2348C_0413"
FT                   /product="predicted transporter with NAD(P)-binding
FT                   Rossmann-fold domain"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07961"
FT                   /db_xref="GOA:B7UKF8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKF8"
FT                   /protein_id="CAS07961.1"
FT                   /translation="MHHTTPLITTIVGGLVLAFILGMLANKLRISPLVGYLLAGVLAGP
FT                   FTPGFVADTKLAPELAELGVILLMFGVGLHFSLKDLMAVKSIAIPGAIAQIAVATLLGM
FT                   ALSAVLGWSLMTGIVFGLCLSTASTVVLLRALEERQLIDSQRGQIAIGWLIVEDLVMVL
FT                   TLVLLPAVAGMMEQGDVGFATLAVDMGITIGKVIAFIAIMMLVGRRLVPWIMARSAATG
FT                   SRELFTLSVLALALGIAFGAVELFDVSFALGAFFAGMVLNESELSHRAAHDTLPLRDAF
FT                   AVLFFVSVGMLFDPLILIQQPLAVLATLAIILFGKSVAALFLVRLFGHSQRTALTIAAS
FT                   LAQIGEFAFILAGLGMALNLLPQAGQNLVLAGAILSIMLNPVLFALLEKYLAKTETLEE
FT                   QTLEEAIEEEKQIPVDICNHALLVGYGRVGSLLGEKLLASDIPLVVIETSRTRVDELRE
FT                   RGVRAVLGNAANEEIMQLAHLECAKWLILTIPNGYEAGEIVASARAKNPDIEIIARAHY
FT                   DDEVAYITERGANQVVMGEREIARTMLELLETPPAGEVVTG"
     atgcatcaca ccaccccgct tatcaccacc attgttggcg gccttgtgct cgcctttatc        60
     ctcggcatgc tggccaataa actacgtatt tctcctctgg tgggatatct gttagcgggt       120
     gtgctggcag gaccattcac tccgggcttt gttgccgata ccaagcttgc gccggaactg       180
     gctgaactgg gcgttatttt gctgatgttc ggcgtcggtt tgcatttttc gctcaaggat       240
     ttgatggcgg taaagtccat cgccattccc ggcgcgatcg cccagatagc cgtggcgacg       300
     ctgctgggta tggcgctctc cgccgtgctg ggctggtcgt taatgaccgg tatcgtgttc       360
     ggcttatgtc tttccaccgc cagtaccgtg gtgttactgc gcgcacttga agaacggcaa       420
     ttaattgaca gtcagcgtgg gcaaatcgcc atcggttggt tgattgtgga agacctggtg       480
     atggtcctga cgctggtatt gctacccgcg gtagcaggaa tgatggaaca gggcgatgtg       540
     ggctttgcca ctcttgcagt cgatatgggg atcaccatcg gcaaggtgat cgcatttatc       600
     gccattatga tgctggtagg tcgccgtctg gtgccgtgga ttatggcacg cagcgcagca       660
     accggttccc gcgagctgtt taccctgtcg gtgctggcgc tggcgttagg gattgccttt       720
     ggtgcggtag agctgtttga tgtctccttt gcactcggtg cgttctttgc cgggatggta       780
     ctgaacgagt ctgaactgag tcaccgtgcc gcccacgata cactgccatt gcgcgacgcg       840
     tttgcggtgc tgttttttgt ctccgtcggg atgttgtttg atccgttaat tctgattcag       900
     caaccgctgg cagtactggc gacgctggca attattctgt ttggtaaatc ggtcgcggcc       960
     ctgttccttg tgcgtttgtt tggtcactcc cagcgcacgg cgttaaccat cgccgccagc      1020
     ctggcgcaga ttggtgagtt cgcgtttatc ctggcgggac taggaatggc attgaattta      1080
     ctgccgcagg ccggacaaaa cctggtactg gcaggggcga tcctgtcgat tatgctcaac      1140
     ccggtactgt tcgcactact ggagaaatat ctggcgaaga ccgaaacgct ggaagagcag      1200
     acgctggaag aggcaatcga agaagagaag cagatcccag tggatatttg caaccatgcg      1260
     ctactggtgg gttacggtcg tgtaggcagc ctgctggggg agaaattgct cgcctctgat      1320
     attccgctgg tggtgattga gacgtcacga acccgtgttg atgagctgcg cgagcgcggg      1380
     gtccgcgcag tattgggcaa tgcggcgaac gaagaaatta tgcaactggc gcatctggaa      1440
     tgtgcaaaat ggctgatcct gacgattccc aacggctatg aagcgggcga gattgtggca      1500
     tctgcccgcg cgaaaaatcc ggatattgag attattgccc gcgcccatta tgacgatgaa      1560
     gtggcgtata tcaccgaacg tggtgcgaat caggtagtga tgggtgagcg tgaaattgcc      1620
     cgtactatgc tggaactgct ggaaacgcca ccggcgggtg aggtggtgac ggggtaa         1677
//

If you have problems or comments...

PBIL Back to PBIL home page