(data stored in ACNUC7421 zone)

EMBL: FM180568.YBAM

FM180568.YBAM        Location/Qualifiers
FT   CDS_pept        complement(450587..450748)
FT                   /transl_table=11
FT                   /gene="ybaM"
FT                   /locus_tag="E2348C_0401"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07949"
FT                   /db_xref="InterPro:IPR019630"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKE6"
FT                   /protein_id="CAS07949.1"
FT                   /translation="MSLENAPDDVKLAVDLIVLLEENQIPARTVLRALDIVKRDYEKKL
FT                   TRDDEAEK"
     atgtcactgg aaaatgcccc tgacgatgtc aaactggccg tcgatttgat tgtgctgctg        60
     gaagaaaatc agatcccagc ccgcaccgta ctgcgcgcgc tggatattgt aaaacgcgat       120
     tatgaaaaga aattaacgcg cgatgatgag gcggaaaagt ga                          162
//

If you have problems or comments...

PBIL Back to PBIL home page