(data stored in ACNUC7421 zone)

EMBL: FM180568.YBAN

FM180568.YBAN        Location/Qualifiers
FT   CDS_pept        451359..451736
FT                   /transl_table=11
FT                   /gene="ybaN"
FT                   /locus_tag="E2348C_0403"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07951"
FT                   /db_xref="GOA:B7UKE8"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKE8"
FT                   /protein_id="CAS07951.1"
FT                   /translation="MQRIILIIIGWLAVVLGTLGVVLPVLPTTPFILLAAWCFARSSPR
FT                   FHAWLLYRSWFGSYLRFWQKHHAMPRGAKPRAILLILITFTISLWFVQMPWVRIMLLVI
FT                   LACLLFYMWRIPVIDEKQEKH"
     atgcaacgaa tcattttaat catcattggc tggctggcgg tagtgctggg tacgctaggc        60
     gtggtattac cggtattacc gacgacgccg tttatcctgc tggcggcctg gtgctttgcc       120
     cgttcttccc cgcgctttca cgcctggttg ctgtaccgct catggtttgg cagttatcta       180
     cgtttctggc agaaacatca tgcgatgccg cgcggcgcaa aaccacgggc gattttgctt       240
     attttgatta cgtttacgat ttcgctgtgg ttcgtccaga tgccgtgggt gcgcatcatg       300
     ttgctggtaa ttctcgcctg tttgcttttt tatatgtggc gaattccggt gattgatgaa       360
     aagcaagaaa agcactga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page