(data stored in ACNUC7421 zone)

EMBL: FM180568.YBAP

FM180568.YBAP        Location/Qualifiers
FT   CDS_pept        complement(467656..468450)
FT                   /transl_table=11
FT                   /gene="ybaP"
FT                   /locus_tag="E2348C_0417"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07965"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKG2"
FT                   /protein_id="CAS07965.1"
FT                   /translation="MDLLYRVKTLWAALRGNHYTWPAIDISLPGNRHFHLIGSIHMGSH
FT                   DMAPLPTRLLKKLKNADALIVEADVSTSDTPFANLPACEALEERISEEQLQNLQHISQE
FT                   MGISPSLFSTQPLWQIAMVLQATQAQKLGLRAEYGIDYQLLQAAKQQHKPVIELEGAEK
FT                   QIAMLLQLPDKGLALLDDTLTHWHTNARLLQQMMGWWLNAPPQNNEITLPNTFSQSLYD
FT                   VLMHQRNLAWRDKLRDMPPGRYVVAVGALHLYGEGNLPQMLR"
     atggatctgt tgtaccgggt aaaaacgctt tgggccgcgc tgcgcggtaa tcattacacc        60
     tggcctgcta tcgatatctc tcttcccggc aatcgccatt ttcatctgat cggcagtatt       120
     catatgggta gccacgatat ggctcccctg cccacccgtt tgctcaaaaa gctcaaaaac       180
     gccgatgcgc tgatcgtcga ggcggatgtt tccaccagcg atacgccttt tgccaatttg       240
     cctgcctgcg aggcactgga agagcgcatt agcgaggagc aactccaaaa cctgcagcac       300
     attagccagg agatgggcat ttctccgtca ctcttttcta ctcaaccgtt gtggcaaatc       360
     gcgatggttc ttcaggcgac gcaggcgcaa aaactggggc tgcgggcaga atatggtatc       420
     gattaccagc tattgcaggc ggcgaagcaa caacataaac ctgtaattga actggaaggc       480
     gcagaaaaac agattgccat gttgctccag ctccctgaca aaggactggc gctgctggac       540
     gatacgctga cccactggca caccaatgca cggttgctgc aacaaatgat gggctggtgg       600
     ctgaatgcgc cgccgcaaaa taatgaaata acgctgccca atacattcag tcagtcgctg       660
     tacgatgtgc tgatgcatca gcgaaatctc gcctggcggg acaaattacg cgacatgccg       720
     ccggggcgct atgtggtcgc ggtcggtgct ttacatctgt atggagaagg gaatttgccg       780
     cagatgttgc gctaa                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page