(data stored in ACNUC7421 zone)

EMBL: FM180568.YBAV

FM180568.YBAV        Location/Qualifiers
FT   CDS_pept        422842..423213
FT                   /transl_table=11
FT                   /gene="ybaV"
FT                   /locus_tag="E2348C_0377"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07925"
FT                   /db_xref="GOA:B7UJR5"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJR5"
FT                   /protein_id="CAS07925.1"
FT                   /translation="MKHGIKALLITLSLACAGMSHSALAAAPAAKPTTVETKAEAPAAQ
FT                   SKAAVPAKASDEEGTRVSINNASAEELARAMNGVGLKKAQAIVSYREEYGPFKTVEDLK
FT                   QVPGMGNSLVERNLAVLTL"
     atgaaacacg gaattaaagc actgctcatt accctgtccc tggcctgtgc cggaatgtct        60
     catagcgcgc tggcggcagc tcctgcggca aaaccgacaa cggtagaaac caaagcggaa       120
     gctcctgcag cacaaagtaa agcagcagtt ccggcgaaag ccagtgacga agaaggcacc       180
     cgggtcagca ttaataatgc cagcgcggaa gagttagccc gcgcgatgaa tggcgttggc       240
     ctgaagaaag cgcaggcgat tgtcagttat cgcgaagagt acggtccgtt taaaacggtg       300
     gaggatctaa agcaggtgcc ggggatgggc aattcgctgg tggaacgtaa tctggcggta       360
     ttaaccctgt aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page