(data stored in ACNUC7421 zone)

EMBL: FM180568.YBAW

FM180568.YBAW        Location/Qualifiers
FT   CDS_pept        423319..423717
FT                   /transl_table=11
FT                   /gene="ybaW"
FT                   /locus_tag="E2348C_0378"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07926"
FT                   /db_xref="GOA:B7UJR6"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJR6"
FT                   /protein_id="CAS07926.1"
FT                   /translation="MQTQIKVRGYHLDVYQHVNNARYLEFLEEARWHGLENSDSFHWMT
FT                   AHNIAFVVVNININYRRPAVLSDLLTITSQLQQLNGKSGILSQIITLEPEGQVVADALI
FT                   TFVCIDLKTQKALALEGELREKLEQMVK"
     atgcaaacac aaatcaaagt tcgtggatat catctcgacg tttaccagca cgtaaacaac        60
     gcccgctacc ttgaatttct cgaagaagcc cgctggcatg ggttggaaaa tagcgacagt       120
     tttcactgga tgacggccca taacatcgcc ttcgtcgtgg tcaatatcaa tattaactat       180
     cgccgcccgg cggtattaag cgacctgtta accattacca gtcagttgca gcaattaaac       240
     ggtaaaagtg gcatcttaag ccagatcatt acactggagc cggaaggaca ggtggtagcg       300
     gatgcgctta ttacgtttgt ttgtattgat cttaaaacgc agaaagcatt agctctggaa       360
     ggggaattgc gcgaaaagct ggagcagatg gttaagtaa                              399
//

If you have problems or comments...

PBIL Back to PBIL home page