(data stored in ACNUC7421 zone)

EMBL: FM180568.YBBA

FM180568.YBBA        Location/Qualifiers
FT   CDS_pept        483184..483870
FT                   /transl_table=11
FT                   /gene="ybbA"
FT                   /locus_tag="E2348C_0434"
FT                   /product="predicted transporter subunit: ATP-binding
FT                   component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07982"
FT                   /db_xref="GOA:B7UKH8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKH8"
FT                   /protein_id="CAS07982.1"
FT                   /translation="MPAENIVEVHHLKKSVGQGEHELSILTGVELVVKRGETIALVGES
FT                   GSGKSTLLAILAGLDDGSSGEVSLVGQPLHNMDEEARAKLRAKHVGFVFQSFMLIPTLN
FT                   ALENVELPALLRGESSAESRNGAKALLEQLGLGKRLDHLPAQLSGGEQQRVALARAFNG
FT                   RPDVLFADEPTGNLDRQTGDKIADLLFSLNREHGTTLIMVTHDLQLAARCDRCLRLVNG
FT                   QLQEEV"
     atgccagcgg aaaacattgt tgaagttcat catcttaaga agtccgtcgg tcagggggag        60
     catgaactct ccatcctcac cggagttgag ctggttgtca aacgtggtga gaccattgca       120
     ctggtgggcg agtcgggatc gggtaagtca accttgctgg cgatcctcgc agggctggat       180
     gacggcagca gtggcgaagt gagtctggtg ggacaaccgc tacataatat ggacgaagaa       240
     gcgcgggcaa agttgcgcgc gaagcacgta ggctttgttt ttcagtcatt tatgttaatt       300
     cctaccctta acgcgctgga aaacgtcgag cttccggcgc tgctgcgcgg tgagagtagc       360
     gcagaaagtc gtaacggggc gaaagcgttg ctcgaacagt tagggctggg taaacgtctt       420
     gatcatcttc cggcacagct ttctggcggc gaacagcaac gagtggcgct ggcgcgagcc       480
     tttaatggtc gacctgatgt gctgtttgcc gacgagccca ccggcaacct tgaccgccag       540
     accggcgata aaattgccga cctgctgttt tccctcaacc gtgagcatgg caccacgttg       600
     attatggtga cccacgacct gcaactggcg gcacgctgcg accgctgctt acggctggtg       660
     aacgggcagt tgcaggagga agtatga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page