(data stored in ACNUC7421 zone)

EMBL: FM180568.YBBJ

FM180568.YBBJ        Location/Qualifiers
FT   CDS_pept        complement(477852..478307)
FT                   /transl_table=11
FT                   /gene="ybbJ"
FT                   /locus_tag="E2348C_0427"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07975"
FT                   /db_xref="GOA:B7UKH1"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKH1"
FT                   /protein_id="CAS07975.1"
FT                   /translation="MELMVVHQHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLVV
FT                   WLLPLGWEWQGVMFAVLTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGQRFVLES
FT                   PLVNGRGHMRVGDSSWPVSASEDLGAGTHVEVIAIEGITLIIRAVIA"
     atggagttaa tggtcgtcca tcaacatatt ttctggctaa gtctcggcgg tttgctgctg        60
     gcagccgaga tgttgggcgg caatggttat ctgttgtgga gcggcgtggc agcggtgatt       120
     accggtctgg tggtctggtt gctgccgctg ggttgggagt ggcaaggggt aatgtttgcc       180
     gtcctgacgc tgctcgccgc ctggctgtgg tggaaatggt tgtcgcggcg ggtgcgcgaa       240
     caaaagcaca gcgacagtca tttaaaccag cgcgggcagc agttgattgg ccaacgtttt       300
     gttctggaat ctccgctggt caacgggcgc ggtcatatgc gcgtcggtga cagttcatgg       360
     cctgtcagcg ccagcgagga tctcggcgct ggtacgcatg ttgaggtgat tgcgatagaa       420
     ggaataacgc tgattatccg tgcggtcatc gcctga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page