(data stored in ACNUC7421 zone)

EMBL: FM180568.YBBL

FM180568.YBBL        Location/Qualifiers
FT   CDS_pept        479370..480047
FT                   /transl_table=11
FT                   /gene="ybbL"
FT                   /locus_tag="E2348C_0429"
FT                   /product="predicted transporter subunit: ATP-binding
FT                   component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07977"
FT                   /db_xref="GOA:B7UKH3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKH3"
FT                   /protein_id="CAS07977.1"
FT                   /translation="MQENSPLLQLQNVGYLAGDTKILNNINFSLRAGEFKLITGPSGCG
FT                   KSTLLKIVASLISPTSGTLLFEGEDVSTLKPEIYRQQVSYCAQTPTLFGDTVYDNLIFP
FT                   WQIRNQQPDPAIFLDFLERFALPDSILTKNIAELSGGEKQRISLIRNLQFMPKVLLLDE
FT                   ITSALDESNKHNVNEMIHRYVREQNIAVLWVTHDKDEINHADKVITLQPHAGEMQEARY
FT                   ELA"
     atgcaggaaa atagtccttt gcttcagcta caaaacgtag gatatctggc gggtgatacg        60
     aagattctta ataacatcaa tttttcgctg cgtgctggcg aatttaagtt aattaccggt       120
     ccttctggtt gtggcaaaag tacactgcta aaaatagttg cttcattgat cagcccaacc       180
     agcggaacgt tactgtttga aggtgaggat gtcagcacac taaagccaga aatctaccgc       240
     cagcaagtct cttactgcgc ccagacgccg acgctgtttg gcgatacggt atacgataac       300
     ctgatttttc cctggcagat ccgtaaccag cagcctgacc cggccatttt tctcgatttt       360
     cttgaacgct tcgctttacc ggacagcatt ttgacgaaga atatcgccga gctatctggt       420
     ggtgaaaaac aacgcatctc attgattcgt aacctgcaat ttatgccgaa ggttttattg       480
     ctcgacgaaa tcaccagtgc gctggatgaa agtaataaac ataacgttaa tgagatgatc       540
     caccgttatg tgcgcgagca aaatattgcc gtgctgtggg tgacacacga taaagacgaa       600
     attaatcatg cggataaggt gattacactg caaccgcatg ccggagaaat gcaggaagca       660
     cgctatgaac tcgcataa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page