(data stored in ACNUC7421 zone)

EMBL: FM180568.YBBM

FM180568.YBBM        Location/Qualifiers
FT   CDS_pept        480034..480813
FT                   /transl_table=11
FT                   /gene="ybbM"
FT                   /locus_tag="E2348C_0430"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07978"
FT                   /db_xref="GOA:B7UKH4"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKH4"
FT                   /protein_id="CAS07978.1"
FT                   /translation="MNSHNITNESLALALMLVVVAILISHKEKLALEKDILWSVGRAII
FT                   QLIIVGYVLKYIFSVDDACLTLLMVLFICFNAAWNAQKRSKYIAKAFISSFIAITVGAG
FT                   ITLAVLILSGSIEFIPMQVIPIAGMIAGNAMVAVGVCYNNLGQRVISEQQQIQEKLSLG
FT                   ATPKQASAILIRDSIRAALIPTVDSAKTVGLVSLPGMMSGLIFAGIDPVKAIKYQIMVT
FT                   FMLLSTASLSTIIACYLTYRKFYNSRHQLVVTQLKKK"
     atgaactcgc ataatattac taacgaatca ttagcactgg cattaatgct ggtggtggtg        60
     gcaatcttaa ttagccataa agaaaaacta gcgctggaga aagatattct ctggagtgtc       120
     gggcgcgcga taatccagct gattattgtc ggctatgtgc tgaagtatat tttcagcgtg       180
     gatgatgcct gtctgacatt attgatggtg ttatttatct gctttaatgc ggcgtggaac       240
     gcgcaaaaac gcagtaaata tattgctaaa gcttttatct catcgtttat tgccattacg       300
     gtcggagcgg gaattaccct ggcggtactg atcctctctg ggtcgattga atttatcccg       360
     atgcaggtga tccctatcgc cgggatgata gccggtaacg ccatggtagc ggtgggggtg       420
     tgttacaaca atttagggca acgggtcatt agcgaacagc aacagattca ggagaaactg       480
     agtcttggcg cgacaccaaa acaggcttca gcgatattga ttcgcgacag tattcgcgcg       540
     gctttaattc cgacggtcga ttcagcaaaa acggttggct tagtgagttt accaggaatg       600
     atgtccgggc tgatatttgc cgggattgat ccggtgaagg cgattaaata tcagattatg       660
     gtgaccttta tgctgctctc aactgccagc ctgtctacca ttattgcctg ctatttaacc       720
     tatcgtaaat tttataattc gcgccaccag ttggtggtga cgcaattgaa gaagaaatga       780
//

If you have problems or comments...

PBIL Back to PBIL home page