(data stored in ACNUC7421 zone)

EMBL: FM180568.YBBN

FM180568.YBBN        Location/Qualifiers
FT   CDS_pept        complement(480876..481730)
FT                   /transl_table=11
FT                   /gene="ybbN"
FT                   /locus_tag="E2348C_0431"
FT                   /product="predicted thioredoxin domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07979"
FT                   /db_xref="GOA:B7UKH5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKH5"
FT                   /protein_id="CAS07979.1"
FT                   /translation="MSVENIVNINESNLQQVLEQSMTTPVLFYFWSERSQHCLQLTPIL
FT                   ESLAAQYNGQFILAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRA
FT                   LLDKVLPREEELKAQQAMQLMQEGNYTDALPLLKDAWQLSNQNGEIGLLLAETLIALNR
FT                   SEDAEAVLKTIPLQDQDTRYQGLVAQIELLKQAADTPEIQQLQQQVAENPEDAALATQL
FT                   ALQLHQVGRNEEALELLFGHLRKDLTAADGQTRKTFQEILAALGTGDALASKYRRQLYA
FT                   LLY"
     atgtccgtag aaaatattgt caacattaac gaatctaacc tgcaacaggt tcttgaacag        60
     tcgatgacca ctccggtgct gttctatttt tggtctgaac gtagccagca ctgtttgcag       120
     ttaaccccaa ttctggaaag cctcgcggcg cagtacaacg ggcaatttat tctggcgaag       180
     ctggactgcg acgcggagca gatgattgcc gcccagtttg gtctgcgcgc gattccgacc       240
     gtatatctgt tccagaacgg gcaaccagta gacggcttcc aggggccgca accggaagag       300
     gcgatccgtg ccctgctgga taaagtgctg ccgcgcgaag aagagctgaa agcgcagcag       360
     gcgatgcagc tgatgcagga aggcaattac accgacgcct tgccattgct gaaagacgcc       420
     tggcagttgt cgaatcagaa cggggagatc ggcctgctgt tggcagaaac gctgattgcg       480
     ctgaaccgtt ctgaagatgc agaagcggtg cttaaaacca ttccattgca ggatcaggac       540
     acccgctacc agggactggt ggcgcaaatc gaactgctga agcaggcggc agatacgccg       600
     gaaattcaac agttgcaaca gcaggtggca gagaatccag aagatgccgc actggcaacg       660
     caactggcac tgcaactgca ccaggttggg cgcaatgaag aggcgctgga gttactgttt       720
     gggcatctgc gtaaagatct caccgccgca gacggtcaga cacgtaaaac gttccaggag       780
     atccttgctg cgctgggtac gggtgatgca ctggcgtcga agtatcgccg ccagctgtat       840
     gcgttgttgt attga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page