(data stored in ACNUC7421 zone)

EMBL: FM180568.YBBO

FM180568.YBBO        Location/Qualifiers
FT   CDS_pept        complement(481791..482600)
FT                   /transl_table=11
FT                   /gene="ybbO"
FT                   /locus_tag="E2348C_0432"
FT                   /product="predicted oxidoreductase with NAD(P)-binding
FT                   Rossmann-fold domain"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07980"
FT                   /db_xref="GOA:B7UKH6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKH6"
FT                   /protein_id="CAS07980.1"
FT                   /translation="MTHKATEILTGKVMQKSVLITGCSSGIGLESALELKRQGFHVLAG
FT                   CRKPDDVERMNSMGFTGVLIDLDSPESVDRAADEVIALTDNCLYGIYNNAGFGMYGPLS
FT                   TISRAQMEQQFSANFFGAHQLTMRLLPAMLPHGEGRIVMTSSVMGLISTPGRGAYAASK
FT                   YALEAWSDALRMELRHSGIKVSLIEPGPIRTRFTDNVNQTQSDKPVENPGIAARFTLGP
FT                   EAVVDKVRHAFISEKPKMRYPVTLVTWAVMVLKRLLPGRVMDKILQG"
     atgactcata aagcaacgga gatcctgaca ggtaaagtta tgcaaaaatc ggtcttaatt        60
     accggatgtt ccagtggtat tggcctggaa agcgcgctcg aattaaaacg ccagggtttt       120
     catgtgctgg caggttgccg gaaaccggat gatgttgagc gcatgaacag catgggattt       180
     accggcgtgt tgatcgatct ggattcacca gaaagtgttg atcgcgcagc cgacgaagtg       240
     atcgccctga ccgataattg tctgtatggg atctataaca atgccggatt cggcatgtat       300
     ggcccccttt ccaccatcag ccgtgcgcag atggaacagc agttttccgc caactttttc       360
     ggcgcacacc agctcaccat gcgcctgtta cccgcgatgt tgccgcacgg tgaagggcgt       420
     attgtgatga cctcatcggt gatgggatta atctccacac cgggtcgtgg cgcttacgcg       480
     gccagtaaat atgcgctgga ggcgtggtca gacgcactgc gcatggagct gcgccacagc       540
     ggaattaaag tcagcctgat cgaacctggt cccattcgta ctcgcttcac cgacaacgtc       600
     aatcagacgc aaagtgataa accagtcgaa aatcctggca tcgccgcccg ctttacgttg       660
     ggaccggaag cggtggtcga caaagtgcgc catgctttta ttagcgagaa gccgaagatg       720
     cgctatccgg tgacgctggt gacctgggcg gtaatggtgc ttaagcgcct gctgccgggg       780
     cgcgtgatgg acaaaatatt gcaggggtga                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page