(data stored in ACNUC7421 zone)

EMBL: FM180568.YBBP

FM180568.YBBP        Location/Qualifiers
FT   CDS_pept        483867..486281
FT                   /transl_table=11
FT                   /gene="ybbP"
FT                   /locus_tag="E2348C_0435"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07983"
FT                   /db_xref="GOA:B7UKH9"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKH9"
FT                   /protein_id="CAS07983.1"
FT                   /translation="MIARWFWREWRSPSLLIVWLALSLAVACVLALGNISDRMEKGLSQ
FT                   QSREFMAGDRALRSSREVPQAWLEEAQKRGLKVGKQLTFATMTFAGDTPQLANVKAVDD
FT                   IYPMYGELQTNPPGLKPQAGSVLLAPRLMALLNLKTGDTIDVGDATLRIAGEVIQEPDS
FT                   GFNPFQMAPRLMMNLADVDKTGAVQPGSRVTWRYKFGGSENQLDGYEKWLLPQLKPEQR
FT                   WYGLEQDEGALGRSIERSQQFLLLSALLTLLLAVAAVAVAMNHYCRSRYDLVAILKTLG
FT                   AGRAQLRKLIVGQWLMVLALSAVTGGAIGLLFENVLMVLLKPVLPAALPPASLWPWLWA
FT                   LGTMTVISLLVGLRPYRLLLATQPLRVLRNDVVANVWPLKFYLPIVTVVVVLLLAGLMG
FT                   GSMLLWAVLAGAVVLALLCGVLGWMLLNVLRRMTLKSLPLRLAVSRLLRQPWSTLSQLS
FT                   AFSLSFMLLALLLVLRGDLLDRWQQQLPPESPNYFLINIATEQVTPLKAFLAEHQIVPE
FT                   SFYPVVRARLTAINDKPTEGNGDEALNRELNLTWQNTRPDHNPIVAGNWPPKADEVSME
FT                   EGLAKRLNVALGDTVTFMGDTQEFRAKVTSLRKVDWESLRPNFYFIFPEGALDGQPQSW
FT                   LTSFRWENGNGMLTQLNRQFPTISLLDIGAILKQVGQVLEQVSRALEVMVVLVTACGML
FT                   LLLAQVQVGMRQRHQELVVWRTLGAGKKLLRTTLWCEFAMLGFVSGLVAAIGAETALAV
FT                   LQSKVFDFPWEPDWRLWIVLPCSGALLLSLCGGWLGARLLKGKALFRQFAG"
     atgattgcac gttggttctg gcgcgaatgg cgttcgccgt cgctattaat tgtctggctg        60
     gcgctaagcc tggcggtggc ctgcgtgctg gcgctgggca atatcagcga tcgcatggag       120
     aagggcttaa gccagcaaag ccgggagttt atggcgggcg atcgggcgtt gcgcagttcg       180
     cgcgaagtgc cgcaagcatg gctggaggaa gcgcaaaagc gcggcctgaa agtcggcaag       240
     cagctgactt tcgccaccat gacctttgca ggcgacacgc cgcaactggc gaacgtcaaa       300
     gcggtggatg atatctaccc gatgtatggc gagctacaaa ccaatccccc tggcctgaaa       360
     ccgcaggcgg gcagcgtatt gctggcccca cgcctgatgg cactgcttaa cctgaaaacg       420
     ggcgacacca ttgacgtggg cgatgccacc ttgcggattg ccggagaagt gattcaggaa       480
     ccggattccg gttttaaccc cttccagatg gctccgcgtc tgatgatgaa tctggcggat       540
     gtcgataaaa ccggagccgt gcagccgggg agtcgggtca cctggcgcta taaattcggc       600
     ggcagcgaga accagctcga cggctatgag aaatggttgt taccccagct taaacctgaa       660
     caacgctggt acggtctgga acaggacgaa ggcgcgctgg ggcgatcgat agaacgttcg       720
     caacagttcc tgctgctttc ggcgcttctg accttgctgc tggcggtggc ggcggttgcg       780
     gtggcgatga atcattactg tcgcagtcgc tacgacttgg tggcgatcct caagacgctg       840
     ggggcagggc gagcgcaact gcgtaagtta atcgtcggtc agtggttgat ggtgctggcg       900
     ctttcagccg ttaccggtgg ggcgataggc ctgttgttcg aaaacgtgtt gatggtgctg       960
     ctcaagcccg tgctacctgc cgctttacct cctgccagcc tctggccgtg gctgtgggcg      1020
     ctcggcacca tgacggttat ttcgctgctg gtggggctac gaccataccg cctgttgttg      1080
     gcaacgcagc ctttacgcgt attacgtaat gatgtggtag cgaacgtctg gccgctgaag      1140
     ttttatctgc cgattgtcac cgtggtggtt gtgctgctgc tcgccggatt aatgggtggc      1200
     agtatgctgc tctgggcggt gctggcgggc gcggtagtac tggctttgct gtgcggtgtg      1260
     ctgggctgga tgctgctgaa tgtacttcgc cgcatgacgc tgaaatcgct acctctgcgc      1320
     ctggcggtta gccgcctgtt acgtcagccg tggtcaacgt taagccagct ttcggcattt      1380
     tcgctctcct ttatgctgct ggcactgttg ctggtgttgc gtggcgatct gctcgaccgt      1440
     tggcaacaac aactgccgcc agaaagcccg aactactttt taatcaacat cgctacggaa      1500
     caggttacgc cgctgaaagc gtttctcgcg gaacatcaaa tagtcccgga atcgttttat      1560
     ccggtggtgc gggcgcggtt gacggcgatt aacgacaagc cgacagaagg caatggagat      1620
     gaggcgctca accgcgagct gaatctcacc tggcaaaata cgcggcctga tcataacccg      1680
     atcgtcgccg gtaactggcc gccaaaagcg gatgaagtgt cgatggaaga ggggctggcg      1740
     aaacgcttaa acgttgccct cggcgatacc gtgactttta tgggcgatac ccaggagttc      1800
     cgcgctaaag tgaccagcct gcgcaaagtg gactgggaaa gtctgcggcc taatttctat      1860
     tttattttcc cggaaggggc attagacggg caaccgcaga gctggcttac cagtttccgc      1920
     tgggagaatg gcaacggcat gttgacgcaa ctcaaccgcc agttcccgac cattagcctg      1980
     ttagacattg gcgcgatttt aaaacaggtc ggtcaggtgc tggagcaggt aagtcgggcg      2040
     ctggaagtga tggtggtgct ggtcaccgcc tgcggcatgt tgctgttgct ggcgcaggtg      2100
     caggtgggaa tgcgtcagcg tcatcaggag ctggtggtgt ggcgcacact tggtgcgggg      2160
     aaaaaactgc tgcgcacgac attgtggtgt gagttcgcca tgctcgggtt tgtatccggc      2220
     ctggtggccg caattggtgc ggaaacggca ctggcggtac tgcaatcgaa agtgtttgat      2280
     ttcccgtggg agccagactg gcgattgtgg attgttctgc cgtgcagcgg tgcgctactg      2340
     ctgtcgcttt gcggcggctg gctgggtgcg cgactgctta agggtaaggc gctgttcagg      2400
     cagtttgcgg ggtga                                                       2415
//

If you have problems or comments...

PBIL Back to PBIL home page