(data stored in ACNUC7421 zone)

EMBL: FM180568.YBCF

FM180568.YBCF        Location/Qualifiers
FT   CDS_pept        508303..509196
FT                   /transl_table=11
FT                   /gene="ybcF"
FT                   /locus_tag="E2348C_0454"
FT                   /product="predicted carbamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08002"
FT                   /db_xref="GOA:B7UKJ8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKJ8"
FT                   /protein_id="CAS08002.1"
FT                   /translation="MKTLVVALGGNALLQRGEALTAENQYRNIASAVPALARLARSYRL
FT                   AIVHGNGPQVGLLALQNLAWKEVEPYPLDVLVAESQGMIGYMLAQSLSAQPQMPPVTTV
FT                   LTRIEVSPDDPAFLQPEKFIGPVYQPEEQEALEAAYGWQMKRDGKYLRRVVASPQPRKI
FT                   LDSEAIELLLKEGHVVICSGGGGVPVAEDGAGSEAVIDKDLAAALLAEQINADGLVILT
FT                   DADAVYENWGTPQQRAIRHATPDELAPFAKADGSMGPKVTAVSGYVRSRGKPAWIGALS
FT                   RIEETLAGEAGTCISL"
     atgaaaacac tggttgtggc tcttgggggc aacgccttac tccagcgcgg tgaggcgctg        60
     acggcagaaa atcaatatcg caatattgcc agtgctgtac ccgcgctggc gcgcctggcc       120
     cgttcttatc ggctggcgat tgttcacggc aacggaccgc aggtggggct gctggcgtta       180
     cagaatctgg cgtggaaaga ggtagaaccg tatccgctgg atgtactggt ggcggaaagc       240
     caggggatga ttggctatat gctggcgcag agcttgagcg cacagccgca gatgccgcct       300
     gtcacgacgg tgctgacgcg cattgaggtt tcgcctgatg atccggcgtt tttacagcca       360
     gagaagttta tcggtccggt ttatcagcca gaagaacaag aggcactgga agcggcttac       420
     ggctggcaga tgaaacgtga tggtaaatat ttacgccggg tggtggcgtc tccgcaaccg       480
     cgtaaaattc tcgacagcga agccatcgag ttgttgctca aagaggggca tgtggtgatt       540
     tgcagtggcg gcggcggtgt gcctgtggcg gaagacgggg cagggagtga agcggtgatt       600
     gataaagatc tcgccgctgc gttgctcgcc gagcagatta atgccgatgg actggtgatc       660
     ctcaccgatg ctgatgcggt atatgaaaac tggggaacgc cgcagcaacg tgccattcgc       720
     catgccacac cggatgagtt agcgccattt gccaaagccg atggttcgat ggggccgaag       780
     gtaacggcgg tgagtggcta tgtcagaagc cgtggtaaac ccgcgtggat tggggcgtta       840
     tcgcggattg aagagacgct ggcgggcgaa gcggggactt gtatttcgct gtag             894
//

If you have problems or comments...

PBIL Back to PBIL home page