(data stored in ACNUC7421 zone)

EMBL: FM180568.YBCH

FM180568.YBCH        Location/Qualifiers
FT   CDS_pept        complement(519549..520439)
FT                   /transl_table=11
FT                   /gene="ybcH"
FT                   /locus_tag="E2348C_0467"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08015"
FT                   /db_xref="InterPro:IPR027849"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKK9"
FT                   /protein_id="CAS08015.1"
FT                   /translation="MRKFIFVLLTLLLVSPFSFAMKGIIWQPQNRDSQVTDTQWQGLMS
FT                   QLRLQGFDTLVLQWTRYGDAFTQPEQRALLFKRAAAAQQAGLKLIVGLNADPEFFMHQK
FT                   QSSAALESYLNRLLAADLQQARLWSAAPGVTPDGWYISAEIDDLNWRSEAARQPLLTWL
FT                   NNAQRLISDVSAKPVYISSFFAGNMSPDGYRQLLEQVKTTGVNVWVQDGSGGDKLTAEQ
FT                   RERYLQASADCQSSAPASGIVYELFVARKGKTFTAKPKPDAEIASLLAKRSSCGKDTLY
FT                   FSLRYLPAAQSILEY"
     atgcgtaagt tcattttcgt attgctgaca ctgcttttgg tcagcccttt ttcctttgcg        60
     atgaaaggta ttatctggca accacaaaac cgtgatagtc aggttaccga tacccagtgg       120
     caggggctga tgagtcagtt acgtttgcaa ggcttcgata ccctggtttt gcaatggacc       180
     cgttacggcg atgcattcac ccagccagaa cagcgcgcgt tattgtttaa gcgtgccgca       240
     gctgcgcaac aggctggcct gaagctgatt gtcgggctga atgccgatcc ggaatttttt       300
     atgcaccaga aacagtcatc cgcggcgctg gaaagctatc ttaatcgcct gctggctgcc       360
     gatctccagc aagccagatt atggagcgcc gcgcctggcg taacgccgga tggctggtac       420
     atcagcgcgg aaattgacga cctgaactgg cgcagcgaag ccgcccgtca acctttgctg       480
     acatggttaa acaacgcgca gcggttgatt agcgatgttt cagcaaaacc ggtttatatc       540
     agtagttttt tcgccggaaa catgtcgccc gatggctatc gccaactgct ggaacaagtt       600
     aaaacaaccg gcgttaatgt ctgggtacag gatggcagcg gcggggataa actgaccgct       660
     gaacagcgtg aacgttatct acaggccagc gccgattgcc aaagttccgc ccctgccagc       720
     ggcattgttt atgaactgtt tgtcgcccgc aaaggcaaaa cctttacagc gaaaccgaaa       780
     ccggatgcag agatcgcctc gctgttagcg aaacgttcct cttgcggtaa agacacgctc       840
     tatttctctc tgcgctattt gcccgccgcg cagagtatcc ttgagtatta a                891
//

If you have problems or comments...

PBIL Back to PBIL home page