(data stored in ACNUC7421 zone)

EMBL: FM180568.YBCI

FM180568.YBCI        Location/Qualifiers
FT   CDS_pept        complement(513934..514455)
FT                   /transl_table=11
FT                   /gene="ybcI"
FT                   /locus_tag="E2348C_0460"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08008"
FT                   /db_xref="GOA:B7UKK4"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKK4"
FT                   /protein_id="CAS08008.1"
FT                   /translation="MPTVITHAAVLLCIGLGLGSKAIPPRLLFAGIILAMLPDADVLSF
FT                   KFGVAYGNVFGHRGFIHSLVFAFVVPLLCVLIGRRWFRTGLIRCWLFLTVSLLSHSLLD
FT                   SVTTGGKGVGWLWPWSDERFFAPWQVIKVAPFALSRYTTLYGHQVIISELMWVWLPGML
FT                   LMGMLWWRRR"
     atgccaaccg ttattacgca cgccgccgtt ctcctatgca ttggtttagg gttgggttcg        60
     aaagccatcc ctccgcgtct gttatttgcc ggaatcatcc tggcgatgct gcccgatgcc       120
     gacgtcttgt cgtttaaatt tggcgttgct tacggcaatg tttttggtca tcgcgggttt       180
     atccattcgc tggtgtttgc gtttgttgtc ccgctgttat gtgtgctgat tgggcgtcga       240
     tggttcagga ctgggctgat tcgctgctgg ctgtttttaa ccgtctcgtt gctatcgcac       300
     agcttgctgg attcggtaac cactggcggt aaaggggttg gctggctgtg gccgtggtca       360
     gatgaacgct ttttcgctcc ctggcaggtg attaaagtcg cgccgtttgc attgtctcgt       420
     tacaccacgc tgtacgggca tcaggtgatt atttctgaat tgatgtgggt gtggttgccg       480
     gggatgctac tgatgggaat gttgtggtgg cgcagacgat aa                          522
//

If you have problems or comments...

PBIL Back to PBIL home page