(data stored in ACNUC7421 zone)

EMBL: FM180568.YBCJ

FM180568.YBCJ        Location/Qualifiers
FT   CDS_pept        complement(514563..514775)
FT                   /transl_table=11
FT                   /gene="ybcJ"
FT                   /locus_tag="E2348C_0461"
FT                   /product="predicted RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08009"
FT                   /db_xref="GOA:B7UKK5"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKK5"
FT                   /protein_id="CAS08009.1"
FT                   /translation="MATFSLGKHPHVELCDLLKLEGWSESGAQAKIAIAEGQVKVDGAV
FT                   ETRKRCKIVAGQTVSFAGHSVQVVA"
     atggcgacat tttctttagg taaacatccg cacgttgagc tgtgcgactt gctgaaactg        60
     gaaggctgga gcgaaagcgg cgcgcaggcg aaaatcgcga tagcagaagg ccaggtgaaa       120
     gtcgacggtg cggttgaaac gcgtaaacgc tgcaaaatcg tcgccggtca gacagtgagt       180
     tttgcaggtc acagcgtaca ggttgttgcc tga                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page