(data stored in ACNUC7421 zone)

EMBL: FM180568.YBDB

FM180568.YBDB        Location/Qualifiers
FT   CDS_pept        560181..560594
FT                   /transl_table=11
FT                   /gene="ybdB"
FT                   /locus_tag="E2348C_0499"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08047"
FT                   /db_xref="GOA:B7UKP0"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR026576"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKP0"
FT                   /protein_id="CAS08047.1"
FT                   /translation="MIWKRHLTLDELNATSDNTMVAHLGIVYTRLGDDVLEAEMPVDTR
FT                   THQPFGLLHGGASAALAETLGSMAGFMMTRDGQCVVGTELNATHHRPVSEGKVRGVCQP
FT                   LHLGRQNQSWEIVVFDERGRRCCTCRLGTAVLG"
     atgatctgga aacgccattt aacgcttgac gagctgaacg ccaccagcga taacacaatg        60
     gtggcgcatc tgggaattgt gtatacccgt ctgggcgatg atgtgctgga agccgaaatg       120
     ccggttgata cccgtactca tcagccgttt ggcctgctgc atggcggcgc gtcggcggcg       180
     ctggcggaaa cgctgggatc gatggccgga tttatgatga cccgcgacgg acagtgtgtg       240
     gtgggcacgg aacttaacgc cacacatcat cgcccggtgt ctgagggaaa ggtgcgcggt       300
     gtctgccagc cgctgcatct tggacgacaa aatcagagct gggaaatcgt cgttttcgat       360
     gaacgggggc ggcgttgctg cacctgtcgg ctgggcacag cggttttggg atga             414
//

If you have problems or comments...

PBIL Back to PBIL home page