(data stored in ACNUC7421 zone)

EMBL: FM180568.YBDF

FM180568.YBDF        Location/Qualifiers
FT   CDS_pept        complement(537919..538302)
FT                   /transl_table=11
FT                   /gene="ybdF"
FT                   /locus_tag="E2348C_0479"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08027"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKM1"
FT                   /protein_id="CAS08027.1"
FT                   /translation="MDKQSLHETAKRLALELPFVELCWPFGPEFDVFKIGGKIFMLSSE
FT                   LRGVPFINLKSDPQKSLLNQQIYPSIKPGYHMNKKHWISVYPGEEISEALLRDLINDSW
FT                   NLVVDGLAKRDQKRVRPDSTVNQ"
     atggataagc aatcactgca cgaaacggcg aaacgcctgg ctcttgagtt accctttgtc        60
     gagctttgct ggccttttgg cccggagttc gatgttttta aaattggcgg caagattttt       120
     atgctgtcgt cggagctacg cggcgtcccc tttatcaatc tgaagtccga tccacaaaaa       180
     tccctgctaa atcagcaaat atacccaagc atcaagcctg ggtatcacat gaataaaaag       240
     cactggattt cggtgtatcc cggcgaggaa atctccgaag cgttacttcg cgatctgatc       300
     aacgattcgt ggaatctggt ggttgatggt ctggctaaac gcgatcaaaa aagagtgcgt       360
     cctgactcaa ccgtaaatca atag                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page