(data stored in ACNUC7421 zone)

EMBL: FM180568.YBDN

FM180568.YBDN        Location/Qualifiers
FT   CDS_pept        complement(566160..567380)
FT                   /transl_table=11
FT                   /gene="ybdN"
FT                   /locus_tag="E2348C_0505"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08053"
FT                   /db_xref="GOA:B7UKP6"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR021845"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKP6"
FT                   /protein_id="CAS08053.1"
FT                   /translation="MSIYKIPLPLNILEAAKERITWTLNTLPRICVSFSGGKDSGLMLH
FT                   LTAEIARQMGKKICVLFIDWEAQFSCTINYVQSLREFYADVIEEFYWVALPLTTQNSLS
FT                   QYQPEWQCWEPDVEWVRQPPQDAITDPDFFSFYQPGMTFEQFVREFAEWFSQKRPAAMM
FT                   IGIRADESYNRFVAIASLNKQRFADDKPWTTAAPGGHSWYIYPIYDWRVADIWTWYANH
FT                   QQLCNPLYNIMYQAGVPLRHMRICEPFGPEQRQGLWLYHVIEPDRWAAMCARVSGVKSG
FT                   GIYAGHDNHFYGHRKILKPEHLDWQEYALLLLNSMPEKTAEHYRNKIAIYLHWYQKKGI
FT                   EVPQTQQGDIGAKDIPSWRRICKVLLNNDYWCRALSFSPTKAKNYQRYNERIKGKRQEW
FT                   GILCNND"
     atgtctattt ataaaatccc gcttccactg aatattctgg aagctgcaaa agaacgtatt        60
     acctggacac ttaataccct accccgtatc tgtgtttctt tttcgggtgg taaagattcc       120
     ggattaatgc tgcatctgac agccgaaatt gcccgacaaa tgggcaaaaa aatctgcgtt       180
     ttgtttatcg actgggaagc gcagttctca tgcactatta actatgttca gtcattacgt       240
     gagttttacg ccgatgtcat cgaagagttt tactgggttg cgctcccgct tacgacgcaa       300
     aattcccttt ctcaatacca acccgaatgg cagtgctggg aacctgatgt cgaatgggtg       360
     cgtcagcccc cgcaagatgc gataaccgat cctgactttt tctcctttta ccagcctggt       420
     atgaccttcg aacaatttgt gcgtgagttt gccgaatggt tttcgcaaaa gcgtccggcg       480
     gcgatgatga tcggcatccg tgcagatgag tcctacaacc gttttgtcgc catcgccagt       540
     ttaaataaac aacgttttgc cgatgataag ccctggacca ccgccgcacc aggcggtcat       600
     agctggtaca tttaccccat ctacgactgg agagtggctg atatctggac ctggtatgct       660
     aaccatcaac agctctgtaa cccactgtat aatataatgt atcaggcagg cgttcctctg       720
     cgtcatatgc gaatttgcga accttttggc ccggagcaac ggcaaggatt atggctctat       780
     cacgttatcg aaccggatcg ctgggctgct atgtgcgcac gagtcagcgg ggtaaaaagt       840
     ggcggcattt acgccggaca tgataatcat ttttatggtc atcggaaaat cctcaagcca       900
     gaacatttag actggcaaga atatgcatta ttgctgctca atagcatgcc ggaaaaaaca       960
     gctgagcatt accgcaataa aatcgccatt tatttgcact ggtatcagaa aaaaggcatc      1020
     gaagttccac aaacccagca aggggacatt ggcgcgaaag atatcccctc ctggcggcga      1080
     atatgcaaag ttttactcaa taacgattac tggtgccggg cattatcatt tagtcctacg      1140
     aaagcgaaga actatcagcg ttataacgaa cggataaaag gaaaacgtca ggaatggggg      1200
     atactatgca acaacgatta a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page