(data stored in ACNUC7421 zone)

EMBL: FM180568.YBDZ

FM180568.YBDZ        Location/Qualifiers
FT   CDS_pept        545009..545227
FT                   /transl_table=11
FT                   /gene="ybdZ"
FT                   /locus_tag="E2348C_0487"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08035"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKM9"
FT                   /protein_id="CAS08035.1"
FT                   /translation="MAFSNPFDDPQGAFYILRNAQGQFSLWPQQCALPAGWDVVCQPQS
FT                   QASCQQWLEAHWRTLTPANFTQLQEAQ"
     atggcattca gtaatccctt cgatgatcca cagggagcgt tttacatttt gcgcaatgcg        60
     caggggcaat tcagtctgtg gccgcaacaa tgcgccttac cggcaggctg ggacgttgtg       120
     tgtcagccgc agtcacaggc gtcctgccag cagtggctgg aagcccactg gcgtactctg       180
     acaccggcga atttcaccca gttgcaggag gcacaatga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page