(data stored in ACNUC7421 zone)

EMBL: FM180568.YBEB

FM180568.YBEB        Location/Qualifiers
FT   CDS_pept        complement(597506..597823)
FT                   /transl_table=11
FT                   /gene="ybeB"
FT                   /locus_tag="E2348C_0537"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08085"
FT                   /db_xref="GOA:B7UKS7"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKS7"
FT                   /protein_id="CAS08085.1"
FT                   /translation="MQGKALQDFVIDKIDDLKGQDIIALDVQGKSSITDCMIICTGTSS
FT                   RHVMSIADHVVQESRAAGLLPLGVEGENSADWIVVDLGDVIVHVMQEESRRLYELEKLW
FT                   S"
     ttgcagggta aagcactcca ggattttgtt atcgacaaaa ttgatgacct caaaggtcag        60
     gacatcatcg ccttagacgt tcagggcaaa tccagcatca ccgactgcat gatcatctgt       120
     acgggtacgt ccagccgcca tgttatgtcc attgctgatc acgttgtgca ggagtctcgc       180
     gcagcgggcc tgttaccgct cggcgtagaa ggtgaaaaca gcgccgactg gattgtcgtg       240
     gatttgggcg atgtgattgt ccatgtcatg caggaagaga gccgtcgcct gtatgaactg       300
     gaaaaactct ggagttaa                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page