(data stored in ACNUC7421 zone)

EMBL: FM180568.YBEL

FM180568.YBEL        Location/Qualifiers
FT   CDS_pept        603805..604287
FT                   /transl_table=11
FT                   /gene="ybeL"
FT                   /locus_tag="E2348C_0543"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0543"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08091"
FT                   /db_xref="InterPro:IPR009912"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKT3"
FT                   /protein_id="CAS08091.1"
FT                   /translation="MNKVAQYYRELVASLSERLRNGERDIDALVEQARERVIKTGELTR
FT                   TEVDELTRAVRRDLEEFAMSYEESLKEESDSVFMRVIKESLWQELADITDKTQLEWREV
FT                   FQDLNHHGVYHSGEVVGLGNLVCEKCHFHLPIYTPEVLTLCPKCGHDQFQRRPFEP"
     atgaacaagg ttgctcaata ttaccgtgaa ctggtcgcgt cactgagcga acgcctgcgc        60
     aatggcgaac gtgatatcga cgcactggtg gaacaggcgc gcgagcgcgt aataaaaaca       120
     ggggagttaa cgcgaaccga ggtcgatgag ctgacgcgag ctgtcagacg tgacctggaa       180
     gagttcgcca tgagctatga agagagcctg aaagaagagt ctgacagcgt ctttatgcgg       240
     gtgattaaag aaagcttgtg gcaggagctg gcagacatca ccgataaaac gcagcttgaa       300
     tggcgcgaag ttttccagga cctcaatcat catggggttt atcacagcgg agaagtggta       360
     gggctgggaa atctggtctg cgagaaatgt cacttccatc tcccgatcta tacaccggaa       420
     gtgctgacgc tatgcccgaa atgtggtcat gatcagttcc agagacgtcc gttcgagccg       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page