(data stored in ACNUC7421 zone)

EMBL: FM180568.YBEZ

FM180568.YBEZ        Location/Qualifiers
FT   CDS_pept        complement(614064..615143)
FT                   /transl_table=11
FT                   /gene="ybeZ"
FT                   /locus_tag="E2348C_0553"
FT                   /product="conserved predicted protein with nucleoside
FT                   triphosphate hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08101"
FT                   /db_xref="GOA:B7UKU3"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKU3"
FT                   /protein_id="CAS08101.1"
FT                   /translation="MFSFRRHTDKRNGLNIDTREITLEPADNARLLSLCGPFDDNIKQL
FT                   ERRLGIEINRRDNHFKLTGRPICVTAAADILRSLYVDTAPMRGQIQDIEPEQIHLAIKE
FT                   ARVLEQSAESVPEYGKAVNIKTKRGVIKPRTPNQAQYIANILDHDITFGVGPAGTGKTY
FT                   LAVAAAVDALERQEIRRILLTRPAVEAGEKLGFLPGDLSQKVDPYLRPLYDALFEMLGF
FT                   EKVEKLIERNVIEVAPLAYMRGRTLNDAFIILDESQNTTIEQMKMFLTRIGFNSKAVIT
FT                   GDVTQIDLPRNTKSGLRHAIEVLADVEEISFNFFHSEDVVRHPVVARIVNAYEAWEEAE
FT                   QKRKAALAAERKREEQEQK"
     atgttcagct tccggcggca tacagataag aggaacggtt tgaacataga cactcgcgaa        60
     atcactctgg agccagcaga caacgcacgt ctgttgagcc tgtgcggccc gtttgatgac       120
     aacatcaaac aactcgaacg ccgtctcggc atcgagatca atcgccgcga taaccacttt       180
     aaactgaccg gccgtccgat ttgcgtcacc gctgcggcag acattctgcg tagcctgtat       240
     gtcgatactg ccccgatgcg cggtcagatt caggatatcg aaccggaaca gatccacctt       300
     gcgattaaag aagcgcgggt actggagcaa agcgcggaga gcgtgccgga gtacggcaaa       360
     gcagtcaata tcaaaaccaa acgcggcgta attaagccgc gcacgccaaa ccaggcgcag       420
     tacatcgcca atattctcga ccatgacatt accttcggcg ttggcccggc gggtacgggt       480
     aaaacctacc tggcagtggc tgcggcagtt gatgccctgg agcgtcagga aattcgccgt       540
     attctgctga ctcgtccggc ggtcgaagcc ggtgagaaac tgggcttcct gcctggcgat       600
     ttaagccaga aagtagaccc gtatctgcgc ccgctgtacg acgcgctgtt tgaaatgctg       660
     ggctttgaga aagtcgagaa actgattgag cgcaacgtta ttgaagtcgc accgctggcc       720
     tatatgcgtg gtcgtacgct gaacgacgcg tttatcattc ttgatgagag ccagaacact       780
     accatcgaac agatgaagat gttcctgacc cgtatcggtt ttaactcaaa agcggttatc       840
     accggcgacg tcacacagat cgacctgccg cgtaatacca agtctggttt gcgtcatgcc       900
     atcgaagtgc tggctgatgt cgaagagatc agctttaact tcttccacag cgaagacgtg       960
     gttcgtcacc cggtggtggc gcgtatcgtt aacgcctatg aagcctggga agaagccgaa      1020
     caaaaacgta aagcggcgct ggcagcagaa cgcaagcgcg aagaacagga acaaaaatga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page