(data stored in ACNUC7421 zone)

EMBL: FM180568.YBFE

FM180568.YBFE        Location/Qualifiers
FT   CDS_pept        complement(642032..642325)
FT                   /transl_table=11
FT                   /gene="ybfE"
FT                   /locus_tag="E2348C_0577"
FT                   /product="lexA-regulated predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0577"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08125"
FT                   /db_xref="GOA:B7UKW7"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKW7"
FT                   /protein_id="CAS08125.1"
FT                   /translation="MAKEQTDRTTLDLFAHERRPGRPKTNPLSRDEQLRINKRNQLKRD
FT                   KVRGLKRVELKLNAEAVEALNELAESRNMSRSELIEEMLMQQLAALRSQGIV"
     atggccaaag aacaaacgga ccgtacgaca ttagatctgt tcgcgcacga gcgtcgaccg        60
     ggacgaccga aaactaatcc gctttcgcgc gatgaacagc tgcgtataaa taaacgcaac       120
     caactaaaac gcgacaaagt acgtggcctt aagcgtgtcg aactgaagct gaacgcggaa       180
     gctgtcgagg cactgaacga gctggcggaa tcgcgcaata tgagccgtag cgagctgatc       240
     gaagagatgt taatgcagca actggcggcg ctgcgtagtc agggcatcgt ttaa             294
//

If you have problems or comments...

PBIL Back to PBIL home page