(data stored in ACNUC7421 zone)

EMBL: FM180568.YBFF

FM180568.YBFF        Location/Qualifiers
FT   CDS_pept        complement(642465..643229)
FT                   /transl_table=11
FT                   /gene="ybfF"
FT                   /locus_tag="E2348C_0578"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0578"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08126"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKW8"
FT                   /protein_id="CAS08126.1"
FT                   /translation="MKLNIRAQTAQNQHNNSPIVLVHGLFGSLDNLGVLARDLVNDHNI
FT                   IQVDMRNHGLSPRDPVMNYPAMAQDLVDTLDALQIDKATFIGHSMGGKAVMALTALAPD
FT                   RIDKLVAIDIAPVDYHVRRHDEIFAAINAVSESDAQTRQQAAAIMHQHLNEEGVIQFLL
FT                   KSFVDGEWRFNVPVLWDQYPHIVGWEKIPAWDHPALFIPGGNSPYVSEQYRDDLLAQFP
FT                   QARAHVIAGAGHWVHAEKPDAVLRAIRRYLND"
     atgaaattga atatccgcgc gcaaactgca caaaaccagc acaataattc tcccatcgtt        60
     cttgtccatg gtctgtttgg tagcctcgac aaccttggcg tactggctcg cgatctggta       120
     aacgatcaca atatcatcca ggttgatatg cgtaaccacg gtctttcacc gagagatccg       180
     gtaatgaatt acccggcgat ggcccaggat cttgttgata ccctggatgc actgcagatc       240
     gacaaagcaa catttatcgg tcactccatg ggcggtaaag cggtaatggc acttactgca       300
     ctggcccccg atcggattga caagctggtg gcaattgata ttgcgccggt cgattatcac       360
     gttcgccggc atgatgagat tttcgcggcc atcaacgcag tcagtgaatc ggacgcacaa       420
     actcgccagc aagcagcagc aataatgcac cagcatctta atgaagaagg ggtgattcag       480
     tttctgctga aatcttttgt tgacggggag tggcgcttta acgtgccggt attgtgggat       540
     cagtatccgc atattgtggg ttgggagaaa atcccggcat gggatcaccc tgccctgttt       600
     atcccaggcg gcaattctcc gtatgttagc gagcagtacc gcgatgattt actggcacaa       660
     tttccacagg cacgggcgca tgtgattgct ggcgcgggtc actgggtcca tgctgaaaaa       720
     ccggatgcgg tattacgcgc tatccgtcgc tatctcaatg attaa                       765
//

If you have problems or comments...

PBIL Back to PBIL home page