(data stored in ACNUC7421 zone)

EMBL: FM180568.YBGA

FM180568.YBGA        Location/Qualifiers
FT   CDS_pept        658177..658686
FT                   /transl_table=11
FT                   /gene="ybgA"
FT                   /locus_tag="E2348C_0590"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0590"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08138"
FT                   /db_xref="InterPro:IPR013560"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKY0"
FT                   /protein_id="CAS08138.1"
FT                   /translation="MNQQLFDDSTLIRIFALHELHNLKDRGLTRGALLDYHSRYKLVFL
FT                   AHSQPEYRKLGPFVADIHRWQSLDDYYNQYRQRVIVLLSHPANRRDHTNVLMHVQGYFR
FT                   PHIDSTERQQLAALIDSYRRGEQPLLAPLMRIKHYMALYPDAWLSGQRYFELWPRVINL
FT                   RHAGVL"
     atgaatcaac aactttttga tgacagcacc cttatccgca tttttgcttt gcatgagtta        60
     cacaatctca aagatcgagg actaacgcgc ggggcgcttc tcgattatca cagccgctat       120
     aaactcgtct ttctggcgca ttctcagccg gagtaccgca aacttggccc gtttgtggct       180
     gatattcacc ggtggcaaag tctggatgac tattacaacc agtaccgcca acgcgtaatt       240
     gttttgcttt ctcaccctgc caaccggcgt gatcatacta acgttttgat gcacgttcag       300
     ggatattttc gcccacatat tgattccaca gaacgccagc agctggcagc gcttatcgac       360
     agttatcgcc gtggcgagca accgcttctt gcgccgctga tgcgtatcaa acactatatg       420
     gcgctttatc ctgacgcctg gctttcaggg cagcgttatt tcgaactttg gccgcgtgtg       480
     attaacttgc gccatgcagg agttttatga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page