(data stored in ACNUC7421 zone)

EMBL: FM180568.YBGE

FM180568.YBGE        Location/Qualifiers
FT   CDS_pept        688242..688535
FT                   /transl_table=11
FT                   /gene="ybgE"
FT                   /locus_tag="E2348C_0619"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0619"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08167"
FT                   /db_xref="GOA:B7ULL5"
FT                   /db_xref="InterPro:IPR011846"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULL5"
FT                   /protein_id="CAS08167.1"
FT                   /translation="MSKIIATLYAVMDKRPLRALSFVMALLLAGCMFWDPSRFAAKTSE
FT                   LEIWHGLLLMWAVCAGVIHGVGFRPQKVLWQGIFCPLLADIVLIIGLIFFFF"
     atgagtaaga ttatcgcaac cttgtatgcg gtaatggaca agcgccccct gcgggcgctt        60
     tccttcgtga tggcacttct gttagcagga tgtatgtttt gggacccatc acgtttcgcc       120
     gcgaagacca gtgaactgga aatctggcat ggtttattgc ttatgtgggc cgtctgtgct       180
     ggtgtgattc acggcgtggg ctttcgtccg cagaaggttc tctggcaagg gattttttgc       240
     ccattgcttg ccgatattgt tctcattatc gggctgattt tcttcttctt ttaa             294
//

If you have problems or comments...

PBIL Back to PBIL home page