(data stored in ACNUC7421 zone)

EMBL: FM180568.YBGF

FM180568.YBGF        Location/Qualifiers
FT   CDS_pept        693468..694259
FT                   /transl_table=11
FT                   /gene="ybgF"
FT                   /locus_tag="E2348C_0626"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0626"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08174"
FT                   /db_xref="GOA:B7ULM2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014162"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR032519"
FT                   /db_xref="InterPro:IPR034706"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULM2"
FT                   /protein_id="CAS08174.1"
FT                   /translation="MSSNFRHQLLSLSLLVGIAAPWAAFAQAPISSVGSGSVEDRVTQL
FT                   ERISNAHSQLLTQLQQQLSDNQSDIDSLRGQIQENQYQLNQVVERQKQILLQIDSLSSG
FT                   GAAAQSTSGDQNGVAASTTPTADAGTANAGAPVKSGDANTDYNAAIALVQDKSRQDDAM
FT                   VAFQNFIKNYPDSTYLPNANYWLGQLNYNKGKKDDAAYYFASVVKNYPKSPKAADAMFK
FT                   VGVIMQDKGDTAKAKAVYQQVISKYPGTDGAKQAQKRLNAM"
     atgagcagta acttcagaca tcaactattg agtctgtcgt tactggttgg tatagcggcc        60
     ccctgggccg cttttgctca ggcaccaatc agtagtgtcg gctcaggctc ggtcgaagac       120
     cgcgtcactc aacttgagcg tatttctaat gctcacagcc agcttttaac ccaactccag       180
     caacaactct ctgataatca atccgatatt gattccctgc gtggtcagat tcaggaaaat       240
     cagtatcaac tgaatcaggt cgtggagcgg caaaagcaga tcctgttgca gatcgacagc       300
     ctcagcagcg gtggtgcagc ggcgcaatca accagcggcg atcaaaacgg tgtggcggca       360
     tcaacgacgc cgacagctga tgctggtact gcgaatgctg gcgcgccggt gaaaagcggt       420
     gatgcaaaca cggattacaa tgcagctatt gcgctggtgc aggataaatc ccgccaggat       480
     gacgcaatgg tggcatttca gaatttcatc aaaaattacc ctgattcaac ttacctgcca       540
     aacgccaatt attggctggg tcagttaaac tacaacaagg gtaaaaaaga tgatgcggcg       600
     tattattttg cttcggtagt gaaaaactat ccgaagtcac cgaaggctgc agatgcgatg       660
     tttaaagtcg gcgtcatcat gcaggacaaa ggtgacaccg caaaagcgaa agccgtatac       720
     cagcaggtta tcagtaaata ccctggtact gatggcgcta aacaggcgca aaaacgtctg       780
     aacgctatgt aa                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page