(data stored in ACNUC7421 zone)

EMBL: FM180568.YBGI

FM180568.YBGI        Location/Qualifiers
FT   CDS_pept        661895..662638
FT                   /transl_table=11
FT                   /gene="ybgI"
FT                   /locus_tag="E2348C_0593"
FT                   /product="conserved metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0593"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08141"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKY3"
FT                   /protein_id="CAS08141.1"
FT                   /translation="MKNTELEQLINEKLNSAAISDYAPNGLQVEGKETVQKIVTGVTAS
FT                   QALLDEAVRLGADAVIVHHGYFWKGESPVIRGMKRNRLKTLLANDINLYGWHLPLDAHP
FT                   ELGNNAQLAALLGITVMGEIEPLVPWGELTMPVPGLELASWIEARLGRKPLWCGDTGPE
FT                   VVQRVAWCTGGGQSFIDSAARFGVDAFITGEVSEQTIHSAREQGLHFYAAGHHATERGG
FT                   IRALSEWLNENTDLDVTFIDIPNPA"
     atgaaaaaca ccgaactgga acaactgatt aacgaaaaac tgaacagcgc ggcgattagt        60
     gattacgcgc cgaatggttt gcaggtggaa ggcaaagaga cagtgcaaaa aattgttacc       120
     ggtgtcactg ccagccaggc tttgctcgat gaggcagtgc gtttgggcgc ggatgcggtc       180
     attgtacatc atggctactt ctggaaaggt gaatctccgg tcattcgcgg aatgaagcgt       240
     aaccgtttaa aaacgttgct ggcgaatgat atcaacctgt atggctggca tttgccgctt       300
     gacgcacatc ctgagctggg caataacgca cagctggcgg cgttactggg gatcacggtc       360
     atgggcgaaa ttgagccgtt ggtgccgtgg ggcgaactga ccatgcctgt gccgggactg       420
     gaactggcct cctggattga agcgcgtctg ggacgtaagc cgttatggtg tggcgatacc       480
     gggcctgagg tggttcagcg cgtcgcctgg tgcacggggg gcgggcaaag ttttatcgat       540
     agcgccgcgc gttttggcgt ggatgctttt attactggcg aagtttctga acagaccatt       600
     cattcagccc gcgagcaggg attgcatttt tatgctgcgg gtcaccatgc cactgaacgc       660
     ggtggtattc gcgcattgag cgagtggctg aatgaaaata ccgatcttga tgtgaccttt       720
     attgatattc ctaatcctgc ataa                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page