(data stored in ACNUC7421 zone)

EMBL: FM180568.YBGJ

FM180568.YBGJ        Location/Qualifiers
FT   CDS_pept        662661..663317
FT                   /transl_table=11
FT                   /gene="ybgJ"
FT                   /locus_tag="E2348C_0594"
FT                   /product="predicted carboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0594"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08142"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKY4"
FT                   /protein_id="CAS08142.1"
FT                   /translation="MQRARCYLIGETAVVLELEPPVTLASQKRIWRLAQRLVDMPNVVE
FT                   AIPGMNNITVILRNPESLALDAIERLQRWWEESEALEPESRFIEIPVVYGGAAGPDLAV
FT                   VAAHCGLSEKQVVELHSSVEYVVWFLGFQPGFPYLGSLPEQLHTPRRAEPRLHVPAGSV
FT                   GIGGPQTGVYPLATPGGWQLIGHTSLSLFDPACDEPILLRPGDSVRFVPQKEGVC"
     gtgcaacgag cgcgttgtta tctgataggt gaaacggcgg tagtactgga actggaaccg        60
     ccggtgacgc tggccagcca gaaacggatc tggcgactgg cacagcgtct ggtggatatg       120
     ccgaatgtgg ttgaagccat tcctggcatg aacaatatca cggtgatttt gcgtaatcct       180
     gagtcgctgg cgctggatgc catagagcgt ttgcaacgct ggtgggagga gagtgaggcg       240
     ctggagccgg agtctcgctt tattgaaatt ccggtagttt acggtggcgc agccggaccg       300
     gatttggcgg tggtcgcggc gcattgtgga ttgagcgaaa aacaggttgt tgaattgcac       360
     tcctccgtgg aatacgtggt ctggttttta ggctttcaac cgggcttccc gtatctcggg       420
     agtttgccgg aacaactaca cacgccacgg cgcgctgaac cgcgcttgca cgttccggca       480
     ggttctgtcg ggatcggcgg gccgcagacc ggtgtttatc cgctggcaac gccgggtggc       540
     tggcagttga ttggtcatac ctcactcagc ctgtttgatc cggcgtgtga cgaacccatc       600
     ttattacgtc cgggagacag cgtgcgcttt gtaccccaga aggagggagt atgctga          657
//

If you have problems or comments...

PBIL Back to PBIL home page