(data stored in ACNUC7421 zone)

EMBL: FM180568.YBGK

FM180568.YBGK        Location/Qualifiers
FT   CDS_pept        663311..664243
FT                   /transl_table=11
FT                   /gene="ybgK"
FT                   /locus_tag="E2348C_0595"
FT                   /product="predicted carboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0595"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08143"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKY5"
FT                   /protein_id="CAS08143.1"
FT                   /translation="MLKIIRAGMYTTVQDGSRHGFRQSGISHCGALDMPALRIANLLVG
FT                   NDANAPALEITLGQLTVEFETDGWFALTGAGCEARLDDNAVWTGWRLPMRAGQRLTLKR
FT                   PQHGMRSYLAVAGGIDVPPVMGSCSTDLKVGIGGLEGRLLRDGDRLPIGKAKRDFMEAQ
FT                   GVKQLLWGNRIRALPGPEYHEFDRASQDAFWRSPWQLSSQSNRMGYRLQGQILKRTTDR
FT                   ELLSHGLLPGVVQVPHNGQPIVLMNDAQTTGGYPRIACIIEADMYHLAQIPLGQPIHFV
FT                   QCSLEEALKARQDQQRYFEQLAWRLHNEN"
     atgctgaaga ttattcgtgc gggcatgtat accactgtgc aggatggcag tcgtcacggt        60
     tttcgccagt cgggtatcag ccactgcggc gcactggata tgcctgcgct gcgcattgct       120
     aacctgctgg tgggtaatga cgccaacgcc cccgcgctgg agatcacgct cggtcagtta       180
     acggttgagt tcgaaactga tgggtggttt gccctgacgg gggctggttg cgaagcgcgg       240
     ctggatgata acgccgtctg gaccggctgg cgattgccaa tgagagcagg ccagcgttta       300
     acgcttaaac gcccgcagca cgggatgcgc agttatctgg cggtcgcggg tggtattgat       360
     gttccgccgg taatgggatc atgcagcacc gatctcaaag tggggattgg cgggttggaa       420
     ggccgtttac tgagggatgg tgaccgactc ccgattggca aagcgaagcg tgattttatg       480
     gaagcgcagg gcgttaaaca gctgctgtgg ggcaaccgca ttcgcgcctt gccggggccg       540
     gaatatcatg agttcgatcg cgcctcgcag gatgcattct ggcgttcgcc ctggcagctt       600
     agctcgcaaa gtaaccggat gggctatcgc ttacaggggc aaattttaaa acgcaccacc       660
     gatcgcgaac tgttatctca cggtttgtta ccaggtgtgg tgcaggtgcc gcataacggg       720
     cagcccattg tgttgatgaa cgatgcgcaa accaccggtg gttacccgcg tattgcctgt       780
     atcattgagg ctgatatgta ccatctggcg caaattccgc tcggtcagcc gattcatttt       840
     gtccagtgtt cactggaaga ggcactgaaa gcacggcaag atcaacaacg ttatttcgaa       900
     caattagcgt ggcggctgca caatgaaaat tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page