(data stored in ACNUC7421 zone)

EMBL: FM180568.YBGL

FM180568.YBGL        Location/Qualifiers
FT   CDS_pept        664233..664967
FT                   /transl_table=11
FT                   /gene="ybgL"
FT                   /locus_tag="E2348C_0596"
FT                   /product="predicted lactam utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0596"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08144"
FT                   /db_xref="GOA:B7UKY6"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UKY6"
FT                   /protein_id="CAS08144.1"
FT                   /translation="MKIDLNADLGEGCASDAELLTLVSSANIACGFHAGDAQTMQACVR
FT                   EAIKNGVAIGAHPSFPDRENFGRSAMQLPPETVFAQTLYQIGALAAITRAQGGVMCHVK
FT                   PHGMLYNQAAKEAQLADAIARAVYACDPALILVGLAGSELIRAGERYGLVTREEVFADR
FT                   GYQADGSLVPRSQPGALIENEEQALAQTLEMVQYGRVKSITGEWAMVTAQTVCLHGDGE
FT                   HALAFARRLRATFAEKGIVVAA"
     atgaaaattg acctgaacgc cgatctgggc gaaggctgcg ccagcgacgc agagctatta        60
     acgctggttt cctctgccaa tattgcctgt ggatttcatg caggcgatgc gcaaaccatg       120
     caggcttgcg tgcgtgaagc aataaaaaac ggtgtcgcga ttggcgcgca cccgagtttt       180
     cccgacaggg aaaattttgg tcgcagcgcc atgcagctgc cgccagaaac cgttttcgcc       240
     cagacgctgt atcaaattgg cgcgctggca gcgattaccc gtgcgcaagg cggcgtaatg       300
     tgtcatgtca aaccgcacgg catgttatac aaccaggcgg cgaaagaggc acaactggca       360
     gacgccatcg ccagagcggt atacgcttgc gatccggcat tgattctcgt cgggctggca       420
     ggaagcgagc tgattcgtgc aggcgaacga tatggcctgg taacgcgcga ggaagtgttt       480
     gccgatcgcg gttatcaggc agacggttcg ctggtgccgc gaagccagcc aggcgcgttg       540
     attgaaaacg aagaacaggc gctggcgcaa acgttggaga tggtgcaata cggcagagtc       600
     aaaagtatca ccggcgaatg ggcaatggtc acggcgcaaa cggtctgcct acatggcgat       660
     ggcgagcacg cactggcgtt cgcccgccga ttacgagcta catttgctga aaaggggatt       720
     gttgtcgcag cataa                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page