(data stored in ACNUC7421 zone)

EMBL: FM180568.YBGS

FM180568.YBGS        Location/Qualifiers
FT   CDS_pept        complement(698521..698901)
FT                   /transl_table=11
FT                   /gene="ybgS"
FT                   /locus_tag="E2348C_0630"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0630"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08178"
FT                   /db_xref="InterPro:IPR020363"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULM6"
FT                   /protein_id="CAS08178.1"
FT                   /translation="MKMTKLATLFLTATLSLASGAALAADSGAQSNNGQANAAADAGQV
FT                   APDARENVAPNNVDNNGVNTGSGGTMLHSDGSSMNNDGMTKDEEHKNTMCKDGRCPDIN
FT                   KKVQTGDGINNDVDTKTDGTTQ"
     atgaaaatga caaaactggc cacactattt ttgactgcca ctctaagcct tgccagcggt        60
     gccgcactgg ctgccgatag cggagcgcaa agcaataacg gccaggcaaa cgccgccgct       120
     gatgcgggcc aggtagcccc tgacgcccgt gaaaatgtcg cgccaaataa cgtcgacaat       180
     aacggggtaa ataccggttc tggtggcaca atgctgcatt cggatggttc ttcaatgaac       240
     aatgacggaa tgaccaaaga tgaagagcac aagaacacca tgtgcaaaga tggtcgctgt       300
     ccggatatca ataaaaaagt ccaaaccggt gatggcatca acaatgatgt cgataccaaa       360
     accgacggta ccacgcagta a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page