(data stored in ACNUC7421 zone)

EMBL: FM180568.YKGB

FM180568.YKGB        Location/Qualifiers
FT   CDS_pept        complement(297535..298128)
FT                   /transl_table=11
FT                   /gene="ykgB"
FT                   /locus_tag="E2348C_0264"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07812"
FT                   /db_xref="GOA:B7UJF5"
FT                   /db_xref="InterPro:IPR007339"
FT                   /db_xref="InterPro:IPR016865"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJF5"
FT                   /protein_id="CAS07812.1"
FT                   /translation="MERYLHLLSRGDKIGLTLIRLSIAIVFMWIGLLKFVPYEADSITP
FT                   FVANSPLMSFFYEHPEDYKQYLTHEGEYKPEARAWQTANNTYGFSNGLGVVEVIIALLV
FT                   LANPVNRWLGLLGGLMAFTTPLVTLSFLITTPEAWVPALGDAHHGFPYLSGAGRLVLKD
FT                   TLMLAGAVMIMADSARDILKQRSNESSSTLKTEY"
     atggaaagat acctgcacct gttaagtcgg ggagataaaa ttggcctgac attgattcgt        60
     ctgagcattg cgattgtttt tatgtggatt gggttattaa agtttgtccc ttacgaggca       120
     gacagcatta caccattcgt cgcaaacagt ccactaatgt cgttctttta tgaacacccg       180
     gaagactata aacagtatct gactcacgaa ggcgaataca aaccagaagc aagagcatgg       240
     caaacggcta ataataccta tggtttttcc aacggtcttg gcgtcgtgga ggtgattatt       300
     gctctgctgg ttttggctaa tcctgtcaat cgctggttag gtttattggg tgggctgatg       360
     gcatttacca cgccgctggt aacactctca tttttaatca ccactccgga ggcatgggta       420
     cccgcattgg gtgacgctca tcatggtttc ccttatttat ccggtgctgg tcgtctggta       480
     ttgaaagata ctctgatgct ggcaggtgct gtcatgataa tggcagattc ggcgcgggat       540
     attcttaaac aacgcagtaa tgaatccagt tcaacgttaa aaactgaata ttga             594
//

If you have problems or comments...

PBIL Back to PBIL home page