(data stored in ACNUC7421 zone)

EMBL: FM180568.YKGC

FM180568.YKGC        Location/Qualifiers
FT   CDS_pept        complement(298485..299810)
FT                   /transl_table=11
FT                   /gene="ykgC"
FT                   /locus_tag="E2348C_0266"
FT                   /product="predicted oxidoreductase with FAD/NAD(P)-binding
FT                   domain and dimerization domain"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07814"
FT                   /db_xref="GOA:B7UJF7"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJF7"
FT                   /protein_id="CAS07814.1"
FT                   /translation="MNKYQAVIIGFGKAGKTLAVTLAKAGWRVALIEQSNAMYGGTCIN
FT                   IGCIPTKTLVHDAQQHTDFVRAIQRKNEVVNFLRNKNFHNLADMPNIDVIDGLAEFINN
FT                   HSLRVHRPGRNLEIHGEKIFINTGAQAVVPPIPGITTTPGVYDSTGLLNLKELPGHLGI
FT                   LGGGYIGVEFASMFANFGSKVTILEAASLFLPREDRDIADNIATILRDQGVDIILNAHV
FT                   ERISHHENQVQVHSEHAQLAVDALLIASGRQPATASLHPENAGIAVNERGAIVVDKQLH
FT                   TTANNIWAMGDVTGGLQFTYISLDDYRIVRDELLGEGRRSTDDRKNVPYSVFMTPPLSR
FT                   VGMTEEQARESGADIQVVTLPVAAIPRARVMNDTRGVLKAIVDNKTQRILGASLLCVDS
FT                   HEMINIVKMVMDAGLPYSILRDQIFTHPSMSESLNDLFSLVK"
     atgaataaat atcaggcagt tattattggt tttggcaagg ctggaaaaac attagccgtc        60
     acgctggcaa aagcaggttg gcgtgtggct ctcatcgaac aatcaaatgc aatgtatggc       120
     gggacctgta ttaatatcgg ctgtatccca accaaaacat tggttcatga cgcacagcag       180
     cacacagatt ttgtccgtgc catacagcgt aaaaatgaag tggttaattt tttacgtaat       240
     aagaattttc ataatcttgc ggatatgccc aatatcgacg tgatcgacgg cctggcggag       300
     tttatcaata atcatagcct gcgtgttcat cggcctggga gaaatctgga gattcatggc       360
     gagaaaattt ttattaatac cggtgcacaa gccgtggttc cgccaattcc tggaattacc       420
     accacgcctg gtgtatatga cagcaccgga ttacttaatc taaaagaatt gcctgggcat       480
     ttaggtattt tgggcggcgg atatattggc gttgagttcg cctctatgtt cgctaatttt       540
     ggcagcaaag taaccatttt agaggcagct tcgctgtttt tgcctcggga agatcgggat       600
     attgctgata atatcgcgac gattttacgc gatcagggcg tcgatataat cctcaatgcc       660
     catgtggagc gaatcagtca ccatgaaaat caagtgcaag tgcatagcga gcacgcccaa       720
     ctggcggtgg atgcactgtt aatagcttcc ggtcgtcaac cggctaccgc ttcgttacat       780
     ccagaaaatg caggtatcgc agtaaacgag cgcggggcaa ttgtcgttga caagcaatta       840
     cataccaccg caaacaatat ttgggcgatg ggagatgtta ccggcgggct gcaatttact       900
     tacatttcac tggatgatta ccgcattgtg cgtgatgaat tgctgggaga aggcagacgt       960
     agtactgatg atcggaaaaa tgtgccttat tccgtattca tgacaccgcc actgtccagg      1020
     gttggtatga cagaagaaca ggccagagag agtggtgctg atattcaggt ggtgacattg      1080
     cctgtagctg caattccgcg tgccagagtg atgaatgata ctcgtggggt attaaaagcg      1140
     attgttgata ataaaaccca acgtatatta ggggcatcac tgctgtgtgt tgactcccac      1200
     gagatgatca atatagtgaa aatggtgatg gatgccgggc tgccttatag catattacgc      1260
     gatcagatat ttactcatcc gtcgatgagc gaatcactca atgatctatt ttcattagtc      1320
     aaataa                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page