(data stored in ACNUC7421 zone)

EMBL: FM180568.YKGF

FM180568.YKGF        Location/Qualifiers
FT   CDS_pept        302149..303576
FT                   /transl_table=11
FT                   /gene="ykgF"
FT                   /locus_tag="E2348C_0269"
FT                   /product="predicted amino acid dehydrogenase with
FT                   NAD(P)-binding domain and ferridoxin-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07817"
FT                   /db_xref="GOA:B7UJG0"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJG0"
FT                   /protein_id="CAS07817.1"
FT                   /translation="MSIKTSNTDFKTRIRQQIEDPIMRKAVANAQQRIGANRQKMVDEL
FT                   GHWEEWRDRAAQIRDHVLSNLDAYLYQLSEKVTQNGGHVYFAKTKEDATRYILQVAQRK
FT                   NARKVVKSKSMVTEEIGVNHVLQDAGIQVIETDLGEYILQLDQDPPSHVVVPAIHKDRH
FT                   QIRRVLHERLGYEGPETPEAMTLFIRQKIREDFLSVEIGITGCNFAVAETGSVCLVTNE
FT                   GNARMCTTLPKTHIAVMGMERIAPTFAEVDVLITMLARSAVGARLTGYNTWLTGPREAG
FT                   HVDGPEEFHLVIVDNGRSEVLASEFRDVLRCIRCGACMNTCPAYRHIGGHGYGSIYPGP
FT                   IGAVISPLLGGYKDFKDLPYACSLCTACDSVCPVRIPLSKLILRHRRVMAEKGITAKAE
FT                   QRAIKMFAYANSHPGLWKVGMMAGAHAASWFINGGKTPLKFGAISDWMEARDLPEADGE
FT                   SFRSWFKKHQAQEKKNG"
     atgtcgatca aaaccagtaa tacagatttt aagacacgca tccgtcagca aattgaagat        60
     ccgatcatgc gtaaagcggt ggcaaacgcg cagcagcgta ttggggcaaa tcggcaaaaa       120
     atggtcgatg aattggggca ctgggaggag tggcgcgatc gggccgccca gatacgtgat       180
     catgttctga gtaatctcga cgcttatctg taccagctct cagaaaaagt gacacaaaac       240
     ggcggtcacg tctattttgc aaaaaccaaa gaagacgcca cccgctacat tttacaggtt       300
     gcccaacgca aaaatgcccg gaaggtagtg aaatctaaat cgatggtgac cgaagagatt       360
     ggtgtcaatc atgtgttgca ggatgccggg attcaggtga ttgaaaccga tctgggtgaa       420
     tacattctcc agctggatca agatccgccc tctcatgttg tggtcccggc aattcataaa       480
     gatcgccatc agatccgtcg agtgctacac gaacgtctgg gctatgaggg gccggaaacg       540
     cctgaagcga tgaccttatt cattcggcaa aaaatccgcg aagatttcct cagtgttgaa       600
     ataggtatta ccggctgtaa tttcgcggtg gcagagaccg gttcggtatg cctggtgacc       660
     aatgaaggta atgcgcgaat gtgtaccacg ctgcctaaaa cgcatattgc agtgatggga       720
     atggagcgta ttgctcccac gtttgcagag gtagatgtat tgatcaccat gctggcgcgc       780
     agtgccgttg gtgcacgttt gacgggatac aacacctggc tgacaggacc gcgcgaagcg       840
     gggcacgttg atggtcctga agagtttcat ctggttattg tcgataacgg gcgttctgag       900
     gtgctggcct ctgaatttcg ggatgtgctg cgctgtattc gttgcggggc ttgtatgaat       960
     acttgtccgg catatcgcca tattggcggt catggatatg gctctattta tccagggcca      1020
     attggtgcgg tgatttcccc gttacttggc ggctataaag attttaaaga tttaccctac      1080
     gcctgctctt tatgcaccgc ttgtgacagc gtgtgtccgg tgcgtattcc gctgtcaaaa      1140
     ctgattttgc gtcatcgtcg ggtgatggct gaaaaaggga tcaccgcaaa agcagagcaa      1200
     cgggcgataa aaatgttcgc ttatgccaat agtcatccag gattgtggaa agtcgggatg      1260
     atggctggtg ctcatgcggc aagctggttt atcaatggcg gcaaaacacc actcaaattt      1320
     ggcgcgatta gcgactggat ggaagcacgc gatcttcctg aagctgacgg agagagtttc      1380
     cgtagttggt ttaagaaaca tcaggcgcag gagaaaaaga atggataa                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page