(data stored in ACNUC7421 zone)

EMBL: FM180568.YKIA

FM180568.YKIA        Location/Qualifiers
FT   CDS_pept        367825..368103
FT                   /transl_table=11
FT                   /gene="ykiA"
FT                   /locus_tag="E2348C_0328"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07876"
FT                   /db_xref="InterPro:IPR024497"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJL6"
FT                   /protein_id="CAS07876.1"
FT                   /translation="MLQSRNDHLRQTALRNAHTPVLLTTLTESQDRSLAINNPQLAADV
FT                   KTVWLKEEPSLLLFVDQPALSQLRDLVKTGATRKIRSEARHRLEEKQ"
     ttgctgcaaa gtcgcaatga tcatttgcgc caaacggcat tgcgcaacgc acataccccg        60
     gtgttgttaa cgacattgac tgagtctcag gatcggtcgc tggctattaa taatccacag       120
     ctggctgccg atgtgaaaac ggtgtggcta aaagaggagc catcattact tttatttgtc       180
     gatcaacccg ctctttcgca gttacgggat ttagtgaaaa ccggggcaac gcggaaaatt       240
     cgcagtgaag cgcgtcaccg gcttgaggaa aaacaatga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page